KEGG   T30595 (Metagenome): 1624
Entry
1624              CDS       T30595                                 

Gene name
yajC
Definition
preprotein translocase, yajC subunit
  KO
K03210  preprotein translocase subunit YajC
Best hit
anx:ACH33_04335 (best score: 76.6405)
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.1624-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_433:8300..8752
AA seq 150 aa
MRCNTLNTFFLAQSAAGMNNMFMIIAMIAIFVFFYFSMIKPQKKQQQERMKMMSELKKGD
QVIMVDGLHGKVDSINDADKTVVIDADGIFLTFERMAIRRVLPTAAAPAKDVEANEAKEE
KVETEEKPTESSKPEETASDKTDDTNSEDK

KEGG   T30595 (Metagenome): 910
Entry
910               CDS       T30595                                 

Gene name
yajC
Definition
preprotein translocase, yajC subunit
  KO
K03210  preprotein translocase subunit YajC
Best hit
ppe:PEPE_1268 (best score: 89.7373)
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.910-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_153:95..460
AA seq 121 aa
VNTLNTFFLAANSSNSMLVTIFMVVIMFGFMYFAMIRPQKKQQQVRMKMLSELKKGDKVI
LLDGMHCKIDTINGDDTIVVDADGIFLTFSRSAIRQILPDDVEANKPVTTNENVETKDEE
K

KEGG   T30595 (Metagenome): 6394
Entry
6394              CDS       T30595                                 

Gene name
yajC
Definition
preprotein translocase, yajC subunit
  KO
K03210  preprotein translocase subunit YajC
Best hit
lpl:lp_2281 (best score: 96.2857)
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.6394-T1-C
LinkDB
Position
C128329:2171..2545
AA seq 124 aa
MNISFMAAAAGFGSYSTIIMMIVLVGFTYFFMIKPQKKRQQQAMDMLSKLKKGDKVILVS
GLHAKIDSVNDKDKTVVVDADGIFLTFSKMAVRQVVESAPKQEVNPAETEEKAASEEEQA
NEDK

DBGET integrated database retrieval system