KEGG   T30595 (Metagenome): 1756
Entry
1756              CDS       T30595                                 

Definition
hypothetical protein
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Best hit
ljf:FI9785_1023 (best score: 73.1738)
Pathway
04010  MAPK signaling pathway
04014  Ras signaling pathway
04015  Rap1 signaling pathway
04066  HIF-1 signaling pathway
04151  PI3K-Akt signaling pathway
04510  Focal adhesion
05202  Transcriptional misregulation in cancer
05323  Rheumatoid arthritis
Other DBs
HMP: SRS047335.1756-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_490:complement(1533..1763)
AA seq 76 aa
MKIDAFAHILTPEFYQTMLDIDASIPQKYPFIKIETLVNLDERIAKWPDKNTKQVISFAN
INPEDLVDGEEASKLA

DBGET integrated database retrieval system