KEGG   T30595 (Metagenome): 2128
Entry
2128              CDS       T30595                                 

Gene name
secA1
Definition
protein translocase subunit secA 1
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Best hit
mps:MPTP_0917 (best score: 219.164)
Taxonomy
Firmicutes - Bacilli [GN:mps]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.2128-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_571:3..533
AA seq 176 aa
EIIMNAGQRGAVTIATNMAGRGTDIKLGPGVKELGGLAVIGTERHESRRIDNQLRGRSGR
QGDPGTTRFYLSLEDDLMKRFGSERVKAFLDRIAGSDDEKVIESRMITRQVESAQKRVEG
NNYDTRKXXXXXXXXXRLHIKLICTLKDLRISGEQIKFVTLLLPVWLVKKMQRRSI

KEGG   T30595 (Metagenome): 1725
Entry
1725              CDS       T30595                                 

Gene name
secA1
Definition
protein translocase subunit secA 1
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Best hit
vte:BHY08_06550 (best score: 412.149)
Taxonomy
Firmicutes - Bacilli [GN:vte]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.1725-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_474:complement(1..843)
AA seq 281 aa
MMTGEGKTLTATMPVYLNALTGQGVHVVTVNEYLSARDESEMGQLYKWLGLTVGLNLNSM
SSDEKREAYSCDVTYSTNSELGFDYLRDNMVVYKEQMVQRPLNYAIIDEVDSILIDEART
PLIISGQAEQANNEYIRADRFVKTLVEDKSDDNMDDNEDHGDYKIDXXXXNYIMLNNIDY
VVQNGEVLIVDSFTGRVMEGRRYSDGLHQAIEAKEGVKIQEESKTQATITYQNFFRMYKK
LSGMTGTAKTEEEEFREIYNMQVITIPTNRPKARKDLPDIL

KEGG   T30595 (Metagenome): 5031
Entry
5031              CDS       T30595                                 

Gene name
secA
Definition
protein translocase subunit secA
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Best hit
lpl:lp_0739 (best score: 92.4337)
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.5031-T1-C
LinkDB
Position
C125988:complement(1..195)
AA seq 65 aa
MVNILKKLYDSDKRELKKFEKLADKVEGYADEMSKLSDAQLQAKTPEFKKRLEDGESLDD
LLPEA

KEGG   T30595 (Metagenome): 4225
Entry
4225              CDS       T30595                                 

Gene name
secA
Definition
protein translocase subunit secA
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Best hit
aur:HMPREF9243_1791 (best score: 143.665)
Taxonomy
Firmicutes - Bacilli [GN:aur]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.4225-T1-C
LinkDB
Position
C122466:complement(1..303)
AA seq 101 aa
MTNILKKLYDNDKRDLKKFEKIANKVEKLADHFANMTDEQLQHMTVEFRDRLAKGESLDD
ILPEAFATAREGAKRVLGLYPFHVQVIGGISLHYGNISEMM

KEGG   T30595 (Metagenome): 2129
Entry
2129              CDS       T30595                                 

Gene name
secA1
Definition
protein translocase subunit secA 1
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Best hit
ppe:PEPE_0428 (best score: 162.155)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.2129-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_571:497..868
AA seq 123 aa
LASEEDAKKINLKNITVDELKEQLYEMVDDNYAEKERQLVDPEQMLEFEKVVILRVVDDR
WTDHIDAMDQLRQSISLRGYGQLNPLVEYQEAGYRMFEEMISNIEYDATRLFMKARIVPN
MSR

KEGG   T30595 (Metagenome): 3137
Entry
3137              CDS       T30595                                 

Gene name
secA
Definition
preprotein translocase, secA subunit
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Best hit
lpl:lp_0739 (best score: 1141.72)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.3137-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_846:complement(6009..8408)
AA seq 799 aa
MANILKKIYDNDRRELKKFEKLATKVESLADEYEKLSDEQLQAKTPEFRKRLEKGETLDD
LLPEAFATAREGAKRVLGLYPFRVQIIGGIALHYGNIAEMMTGEGKTLTATLPVYLNALT
GKGVHVVTVNEYLSSRDESEMGQLYKWLGLTVGLNLNSMSADEKRDAYNCDVTYSTNSEL
GFDYLRDNMVVYKDQMVQRPLNYAIIDEVDSILIDEARTPLIISGQAEQANSEYIRADRF
VKTLTEDKSDDDADDDEDHGDYKIDWPTKTINLTNQGIKKACEHFGLKNLYDIDNQVLVH
HIDQALRANYIMLKDIDYVVQNGEVMIVDSFTGRVMEGRRYSDGLHQAIEAKEGVKIQEE
SKTQATITYQNFFRMYKKLAGMTGTAKTEEEEFREIYNMEVITIPTNRPIARKDLPDILY
PTLDSKFEAVVKEIKERHAKGQPVLVGTVAIESSERLSKMLDQAGIPHAVLNAKNHAKEA
EIIMNAGQRGAVTIATNMAGRGTDIKLGPGVKELGGLAVIGTERHESRRIDNQLRGRSGR
QGDPGVTRFYLSLEDDLMKRFGGDRVKLFLDRISDNDDDKVIESRMITKQVESAQKRVEG
NNYDTRKQTLQYDDVMRTQREIIYGERMQVISEEKTLKPVLMPMIKRTIDHQVDMYTQGD
KKDWRNDQLRDFISSAITDEETTKKLNIKHLGAEELKKRLYKIAEDNYAEKEKQLADPEQ
MLEFEKVVILRVVDERWTDHIDAMDQLRQSISLRGYGQLNPLVEYQEAGYRMFEEMISDI
EFDATRLFMKAQIRQNISR

KEGG   T30595 (Metagenome): 5937
Entry
5937              CDS       T30595                                 

Gene name
secA
Definition
preprotein translocase, secA subunit
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Best hit
lpl:lp_0739 (best score: 1010.36)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.5937-T1-C
LinkDB
Position
C127731:complement(403..2511)
AA seq 702 aa
EMMTGEGKTLTATMPVYLNALTGKGVHVVTVNEYLSGRDEEEMGQLYRWLGLTVGLNLNE
KSPDEKRAAYNCDVTYSTNAELGFDYLRDNMVVYKEQMVQRPLNYAIIDEVDSILIDEAR
TPLIISGEAQQATGEYIRADRFVKTLTEDKSDDDVDDDKDYGDYKIDWPTKTISLTRQGI
AKACEHFGLKNLYDVENQVLVHHIDQALRANYIMLKDIDYVVQDGEVLIVDSFTGRVMQG
RRYSDGLHQAIEAKEGVKIQEESKTQATITYQNFFRMYKKLSGMTGTAKTEEEEFREIYN
MQVITIPTNRPIQRKDMPDILYPTLDAKFKAVVEEIKKRHAKGQPVLVGTVAIENSERLS
KMLDAENIPHAVLNAKNHAKEAEIIMKAGQRGAVTIATNMAGRGTDIKLGPGVRELGGLA
VIGTERHESRRIDNQLRGRSGRQGDPGYSRFYLSLEDDLMKRFGGDRVKVFLDRISDNDD
DKVIESRMITRQVESAQKRVEGNNYDTRKQTLQYDDVMRTQREIIYGERMQVIEEDKSLK
NVLMPMIKRTISHQVDLYTQGDKKDWRIDSLRDFIVSSLTNEEVADKIDLKNIKSADELK
EKLYNLAEENYKDKEETLSDPSQMLEFEKVVILRVVDDRWTDHIDAMDQLRQSIGLRGYG
QLNPLVEYQDAGYRMFEEMVANIEFDATRLFMKAQIRQNIAR

DBGET integrated database retrieval system