KEGG   T30595 (Metagenome): 2360
Entry
2360              CDS       T30595                                 

Gene name
thiD
Definition
phosphomethylpyrimidine kinase
  KO
K00941  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Best hit
ljo:LJ_0515 (best score: 492.656)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
01240  Biosynthesis of cofactors
Other DBs
HMP: SRS047335.2360-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_620:complement(14515..15333)
AA seq 272 aa
MSNEHIEALTIAGHDSDGSAGMPADLHAFYARGVYGMGLLTAAVAGNSQGIFAQQLMPLD
FIQKQFDVLNDDFKIKAVKTGMLANTDIIDVVAKNLKHYQMQNIVLDPVIITKHGATLLA
DDAYQAFLKKLVPLATIITPNFFEAQKLTGLELKNESEIKQGAKLLQKMGAENVLIKGSH
HNDRQPEVKDYLLLDDGSDEWLTKPYFKTDRVNGTGDTLSAVIAAELAKGNDVKTAVKIA
KDFTYEALSHPINVGAKYGPINHLAAQEEMKQ

KEGG   T30595 (Metagenome): 3795
Entry
3795              CDS       T30595                                 

Gene name
thiD1
Definition
phosphomethylpyrimidine kinase
  KO
K00941  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Best hit
sij:SCIP_1235 (best score: 154.836)
Taxonomy
Actinobacteria [GN:sij]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
01240  Biosynthesis of cofactors
Other DBs
HMP: SRS047335.3795-T1-C
LinkDB
Position
C120840:complement(3..299)
AA seq 99 aa
GAKNVLVKGGHFSNDGEANDFVLLENGHSFWMTAKRKQTQNTHGTGDTISSCITAELAKG
KSMEDALKIGKAYVEATIKQGINVGHGHGPLNHWAKIRS

KEGG   T30595 (Metagenome): 6307
Entry
6307              CDS       T30595                                 

Gene name
thiD
Definition
phosphomethylpyrimidine kinase
  KO
K00941  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Best hit
ljo:LJ_0515 (best score: 378.252)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
01240  Biosynthesis of cofactors
Other DBs
HMP: SRS047335.6307-T1-C
LinkDB
Position
C128227:complement(2495..3307)
AA seq 270 aa
MSKKEIIALTIAGNDSDGSAGMPADLHAFYARKVYGMGLMTAAVAGNTTGIYAAQIMPVD
FIQKQFDVLNDDFSIKALKTGMLANKEIINCVADNIEKYDMGKVVIDPVIITKHGNSLLD
DDAYQTFLNRLLPLADIITPNYYEQKKLTELPLDSEAEILVGAKKLQDLGAKNVLMKGKH
TGDSSEVVDILLTEDGQVHKFTKPYYETERVNGTGDTLSAVITAELAKGTNLIDAVKIAK
DFTYEAISHPIIVGSKWGPINHWAAEDKLN

DBGET integrated database retrieval system