KEGG   T30595 (Metagenome): 2552
Entry
2552              CDS       T30595                                 

Gene name
holA
Definition
DNA polymerase III, delta subunit
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Best hit
paek:D3873_07175 (best score: 143.28)
Taxonomy
Firmicutes - Bacilli [GN:paek]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.2552-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_706:2110..3099
AA seq 329 aa
MTLISLFKQTNPKNANLLIQGPDSFFNDYLVRNYLNQKKFSGLDQVIVDCLEDGLDELMA
TLTESSLFSSQKMVVVKNPFFLMAKVPQKYKKQIEKLTKIIEHLDDLEDIVIFVANYEKI
DRRKKVSKFLLEHVNVVETSLKPYEVSGVIKAISKEEGYQITNMALQILMQRSDQVLDAA
LSNYLKLKNIVGEDKKITETLINENIDRSLSENIFEILTAAFNKNYQEATQRLDDHLREG
ASAIQLLAIFESQIEFLTCVKVLQNRRWSKDQITKELKVNPYRVKLAMENKVSLNKLASL
LKQAIELDFRYKNGTYHGDEFLKLFLLKI

KEGG   T30595 (Metagenome): 5604
Entry
5604              CDS       T30595                                 

Gene name
holA
Definition
DNA polymerase III, delta subunit
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Best hit
efa:EF2446 (best score: 126.331)
Taxonomy
Firmicutes - Bacilli [GN:efa]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.5604-T1-C
LinkDB
Position
C127187:1..897
AA seq 298 aa
RDYLNNSEFKGLDLQRIDCENDGLDELLASLTEASLFSQQKIIWVKNPIFLTGKSPKKLQ
ANIAKLEKVFANLTLSDDIVIMQANYANLDKRKKITKLSLSAFNSVEVQFKPYEVSGVIK
AIIKDEGYSIAQNTLHLLLERSDQVMDTALSNYLKLKLIADDNKKITLESVQNNVDLSLA
QNIFEILSSAFKKNYQESLERLEDQLREGQNPVRILSVFENQLEVILSAKILLARKRSEM
DIGKELGIHPYRVKLAKQTQVSVSKLKRLLLEAIKLDQGYKNGTYQGDEFIKMFLLAI

DBGET integrated database retrieval system