KEGG   T30595 (Metagenome): 2569
Entry
2569              CDS       T30595                                 

Gene name
mfd
Definition
transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Best hit
hhd:HBHAL_1070 (best score: 147.902)
Taxonomy
Firmicutes - Bacilli [GN:hhd]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.2569-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_714:complement(1..651)
AA seq 217 aa
MKLSELIAADANLVNFIKAVPQAKNSMLTGVNFGAFNLIIRELLHRLQQPILIVASDENR
AQQIYSSLVELFEENMVHFFPVEPLLETQAAVSSLDELSQRLDAMSFLLTKQKGIVISTP
QALQYPLPAAIKFKANSLTLKVNQVCNLSKICDFLVRCGYKRDDLVANPGEFALRGDILD
IYPINIAYPYRIEFFDDEIDNIRTFNPVSQRTKDSLT

KEGG   T30595 (Metagenome): 4899
Entry
4899              CDS       T30595                                 

Definition
TRCF domain
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Best hit
marr:BKP56_00570 (best score: 314.309)
Taxonomy
Firmicutes - Bacilli [GN:marr]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.4899-T1-C
LinkDB
Position
C125556:2..727
AA seq 242 aa
DILVTTTIIETGIDMPNVNTLIIEDADHYGLSQLYQLRGRIGRSARLAYAYFLYQPNKVL
TEVGEKRLEAIRDFTELGSGFKIAMRDLSIRGAGNMLGQQQHGFIDSVGYDLYAQMLDDA
IKARKGGHKLIKTNSEIDLGIEAYIPDSYISDQQQKIEFYKKIKVISSEEELNSIEDELL
DRFGDYPVATENLLAIAKIKYLADLAGVLEIRYIKDKLKVEFNLESSKHLQGPNIFKALE
HV

KEGG   T30595 (Metagenome): 2536
Entry
2536              CDS       T30595                                 

Gene name
mfd
Definition
transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Best hit
ppe:PEPE_1552 (best score: 753.821)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.2536-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_698:3..1670
AA seq 556 aa
VDNFNQGFVLPRISLVYLTEHDLFNRQPHIHKKIKSLENAQQIRSYQELNPGDYVVHINH
GIGIFEGIKTLESNGQKGDYITITYRNHDQLFVPADQLGVVQKYVASDGKIPKINKLGGN
EWAKTKCRVQEKIEDIADELLAIYAHRATEKGFAFLPDDELQRDFEAAFPYLETPDQIKA
IREIKLDMQKEKPMDRLLVGDVGFGKTEVALRAAFKAIDSGKQVAFLVPTTILAEQHYAT
MLERFKDFPVNVAMLCRFQTEKEADEIATNLSNGKIDIVVGTHRILSRDIKFKNLGLLII
DEEQRFGVKHKEKLKKLKNNIDVLTLTATPIPRTLHMSMIGVRDLSVMETPPANRYPIQT
YVTEETPNIVREACLRELARNGQIFFLHNKIQDIDQKVAYLSQLIPEARIEYIHGRMSER
QLEDIMLRFTQKKFDILVTTTIIETGVDLPNVNTLLVENADTYGLSQLYQLRGRIGRSSR
LAYAYFLYKRDKVLTEVSEKRLNAIRDFTALGSGFKIAMRDLSIRGAGNVLGKQQHGFID
SVGYDLYAQMLDQTIK

KEGG   T30595 (Metagenome): 2834
Entry
2834              CDS       T30595                                 

Gene name
mfd
Definition
transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Best hit
ppe:PEPE_1552 (best score: 1167.14)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.2834-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_762:12200..15697
AA seq 1165 aa
MNITELLNKDKDLNNFINKALKEKRSLLTGVNSGAFSAVLMQMLSTWQRPLILVEDSEDK
AQLLLDELGNLLPDEMVFSFPVDATIATQTAVASPDELSQRLQTLKFLTEKRAGIVVITP
QALQYKLSDPRDFIKAKQVFKPEAEFDLDELTAWFTQAGYRRENIVARPGEFARRGDILD
VYPLDQENPVRIEFFGDEVDTVKEFDAATQRSLEEKDIVSIGPALDRVFSSRNLHEAIEK
IKQDMNESIANEENVKNHFVKAIDLLEADGLPENYAFLIDYLLPKSFNLVDYLDKNGLLL
FDDWQAIKKNVADVDAQNEAFISEEIKAGAMLNSQKLRHNFEQVVQKVKQAQVLFSLFQK
GMGRLKFDQILNFTTREVQQFFSQMPLIKSELTRFANEGNTVVLQADSATRAKQIAQNLV
DYGVDLPVVKPDQILAKKAQITVGDFAHGFALPSLNLVYLTERELFNQRPHHRKRIKTLE
NAQRLRNYNELKPGDYVVHVNHGIGRFEGIKTLDVDGKKRDYITITYQHHDQLFVPADQL
GLVQKYVASEGKVPHINKLGSAEWAKTKKRVQSKVEDIADDLIELYAKRESEKGFAFSPD
DDLQKEFEDAFPYPETPDQLRSIREIKADMESPKPMDRLLVGDVGFGKTEVALRAAFKAI
RDGKQVAFLAPTTILAQQHFETMQDRFKNFPVNCALLSRFQTPAEVKAIIEGVKNGKIDM
VVGTHRLLSKDVKFKDLGLLIVDEEQRFGVKHKERLKELKANIDVLTLTATPIPRTLHMS
MVGVRDLSVMETPPTNRYPIQTYVMEEMPSVVREAVLREMKRNGQVFFLHNRIDDIDKVV
SRLEELIPEAKIEYIHGRMSENQMENIMYRFSRNEFDILVTTTIIETGVDMPNVNTMIVE
NADHYGLSQLYQLRGRIGRSARLAYAYFLYQPNKVLTEIGEKRLSAIRDFTELGSGFKIA
MRDLSIRGAGNMLGKQQHGFIDSVGYDLYAQMLDDAIKKRKGKKVAVKSNAEVQFNLEAY
IPDDYIADQEQKIEFYKKIKGINDQKEAENIADELIDRFGDYPLAVENLLNVSKVKADAD
LAQVVAINQKSNDKLQIIFNNRASEELEGPNIFKALEHVSLRARINMDPQKRMNVMLELE
KKMSTRQLFNELHTFLTAASDIVQR

KEGG   T30595 (Metagenome): 6261
Entry
6261              CDS       T30595                                 

Definition
transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Best hit
efa:EF0257 (best score: 828.935)
Taxonomy
Firmicutes - Bacilli [GN:efa]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.6261-T1-C
LinkDB
Position
C128165:complement(1..2643)
AA seq 881 aa
MKLTEIVAQDKELGAFLINTQKNKKSLLTGINERNLPLILLELLKQNNVLIIIEENENKA
QRLVDNLAPILPEEKVQYFAVDSTLATQRATASPDELAQRIKALHLLLSGDSGIVVTTAQ
GLEYQLNPKDSYIRGNKLIKVGQEYDLKELNKWLVASGYRKEALVAKPGEFAVRGDILDI
YPLDQVSPIRIEFFGDEVDTIKSFDVNTQKSILEKEEIVVLPACDRIFETDNLKKAYNLI
KDEIKESPNSESAEQNFLEVLDELAQGNLPDNYAFLVDYLLPKSCSLLSYLPENGLVVFN
DWQAIKKADSEITDQNADFISDEIKAGLMLNSQKLRMNLTTVLRQSKHHRLYLSLFQKGM
GQLRFDSLFNWPNREPEQFFSQMPLIKSELNKYKKQGYTVILQADNERRSKQIQSNLIDF
DLNLPIVTKENLVEHKLQITVGQFSQGFSLPQIQLVYLTERELFNTQVHKKRKILNLENA
QRLRNYNDLKPGDYVVHVNHGIGRFEGIKTLDVDGQKRDYITITYQGHDQLFVPADQLSL
VQKYVGSEGHRPKVNKLGGSQWAKTKRSVQSKVEDIADDLIKLYAARESEKGFAFSKDND
LQKAFEDAFPYVETPDQLRSSNEIKADMEKPKAMDRLLVGDVGFGKTEVAIRAAFKAIQD
NKQVAFLVPTTILAQQHFDNISDRFKDFPVNVALLSRFQSNAEVKEILEGLKVGKIDLVV
GTHRILSKDVEFKDLGLLIIDEEQRFGVKHKERLKELKNNVDVLTLTATPIPRTLHMSMV
GVRDLSVMETPPVNRYPIQTYVMEQLPSVIREACLREMARDGQIFYLHNRIGDIDETVEH
LHQLVPEAKIEAIHGRMSENQMADILYRFLHKQFDILVTTT

DBGET integrated database retrieval system