KEGG   T30595 (Metagenome): 285
Entry
285               CDS       T30595                                 

Definition
LPXTG-motif cell wall anchor domain protein (fragment)
  KO
K00825  kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39]
Best hit
acg:AWM71_00005 (best score: 120.553)
Taxonomy
Firmicutes - Bacilli [GN:acg]
Pathway
00300  Lysine biosynthesis
00310  Lysine degradation
00380  Tryptophan metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
Other DBs
HMP: SRS047335.285-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_65:complement(303..638)
AA seq 111 aa
TSKTVKVVGVIYRHGDPLVNEKPMFNYQTENPDYTVPNGEDPLGIHQTSQQKQTTDNLSQ
LEANQRVKAASRKKVLPNTGSHSSQTWGGWILTLGGLITLLAGKKRKKEDE

DBGET integrated database retrieval system