KEGG   T30595 (Metagenome): 3005
Entry
3005              CDS       T30595                                 

Gene name
rsgA
Definition
ribosome small subunit-dependent GTPase A
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Best hit
ljo:LJ_1536 (best score: 220.705)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS047335.3005-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_808:2307..2852
AA seq 182 aa
MLEKIAGIVVSVISGYYDIKTDKGIIRSRARGVFRNLKQKPLVGDRVVVQPDDKGINYLV
AVADRTCELQRPALANAEYVLLVMSATQPDFSVDLLDRYLVFFAWKKVKVVIFLSKTDLI
SSDELLKIKSKLNEYQKIGYQYFVDYQDLEQYLQNNIDSDEIWVLAGQSGVGKSTLLNRL
KK

KEGG   T30595 (Metagenome): 2929
Entry
2929              CDS       T30595                                 

Gene name
rsgA
Definition
ribosome small subunit-dependent GTPase A
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Best hit
ljo:LJ_1536 (best score: 518.464)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS047335.2929-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_780:31944..32837
AA seq 297 aa
MNKAQGTIVSAISGYYDVEIENEVVRTRARGVFRDRKQKPLVGDRVVVQLDNQGMNYLIE
ILPRTNEIGRPAVANVSKVLLVISAVEPDFSLELLDRYLTFFAWKNVGVVIYLSKADITP
TEKLKAIKCKLDYYQKIGYSVFEDAEELERQLPTMIQKDQIWTLAGQSGAGKSTLLNKLE
NEANQETGAISTALNRGKHTTRQVKLFKYSSGFIADTPGFSAIDLFKIKVDELGNYFYDL
KDASVKCKFRRCQHIKEPGCEVKKLIEEGKIAKSRYDSYLKIRQEISENRMPEYLKK

KEGG   T30595 (Metagenome): 4554
Entry
4554              CDS       T30595                                 

Gene name
rsgA
Definition
ribosome small subunit-dependent GTPase A
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Best hit
lre:Lreu_1168 (best score: 234.958)
Taxonomy
Firmicutes - Bacilli [GN:lre]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS047335.4554-T1-C
LinkDB
Position
C123940:complement(1..483)
AA seq 161 aa
LRVLPRKNELVRPPVANVDIAVVVTAAKKPTFSTNLLDRQLIALEAQKIIPVIYFSKTDL
LSDDEYAKLAEIVAGYRKIGYQVFFDREAFAEDQLHQLKELLKGQIVTMMGQTGAGKSTL
LNHLAPGLGLATGEISTALKRGRHTTRKVSLFNVAGAWIAD

KEGG   T30595 (Metagenome): 2444
Entry
2444              CDS       T30595                                 

Gene name
rsgA
Definition
putative ribosome biogenesis GTPase rsgA
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Best hit
lah:LA20533_00670 (best score: 56.6102)
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS047335.2444-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_650:1..138
AA seq 45 aa
CQHINEPKCAVKVALNKHDILDSRYNSYIKIREEIALGRIPEYRK

KEGG   T30595 (Metagenome): 6111
Entry
6111              CDS       T30595                                 

Gene name
rsgA
Definition
ribosome small subunit-dependent GTPase A
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Best hit
ljo:LJ_1536 (best score: 376.326)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS047335.6111-T1-C
LinkDB
Position
C127971:complement(19..906)
AA seq 295 aa
MITEGIVISLIAGYYDVMTPNGLVRTRARGVFRKRQEKPQVGDLVKVQLDEHGTNYLIEV
FERKNRIGRPAVSNVSHVLLVISAVEPDFSVNLLDRFLTFFEWQKVPVTIYLSKSDLATK
EQLEAIKSALSYYEEIGYSVFSNKKKLEKALLSLIKDNEIWTLAGQSGAGKSTLLNFLKE
DAGQDTGEISKSLNRGKHTTRSVQLFTYSGGFIADTPGFSAIDLGPIKIKELQNYFVELN
KASKFCKFRGCQHIHEPKCEVKELLSKNKIAQFRYDDYLALRTEIEEQRLPEYLK

DBGET integrated database retrieval system