KEGG   T30595 (Metagenome): 3346
Entry
3346              CDS       T30595                                 

Gene name
dnaX
Definition
DNA polymerase III, subunit gamma and tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Best hit
ppe:PEPE_1484 (best score: 474.552)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.3346-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_868:complement(19776..21584)
AA seq 602 aa
MAYQALYRKWRPRTFDGVVGQTAITDTLKNAIKRGKISHAFLFAGPRGTGKTSCAKIFAK
ALNCTNLQDGEPCNECENCLAADKGTMNDIIEIDAASNNGVDEIRDIRDKVKYAPTQGKY
KVYIIDEVHMLSMGAFNALLKTLEEPPEHVVFILATTELQKVPATIISRTQRYNFKRIDQ
HDLIARMTYILGQEKIDFEEKALEVIAQVADGGMRDSLSILDQILSYDQDKVKYEDALKI
TGYAAQEKIEQVLLDLLKGQTSEAFEIVHNLLQDGASTKNILDELISLTVKGMLVVKSNK
EATFLTKDYATELAKIPEEKFYNLVQAANTALNDLRYTNQQQIPLDVFVVQVTQGVGGNA
PVEQGDSVSSIVVQKLKNEIDNLSKQVAELKNRPVQVTNRSSSDFSGTIKTETNSRPKQI
AAQTANTDQKPKRRKASANNQAAQENNRRQVYHVLENATKEDLNTIKDIWPDLLSTLKVS
QRAVVEVLNPVAASHEQIVLKCKYELWFERANQDGDLISQLEAEIAKLTKHNYSIVLVAD
SSWLKVRHDFVASHKEELLAKKFQKIEKSEQETNENQVDPQAKKEVIDKAKELFGDLAQI
KD

KEGG   T30595 (Metagenome): 2409
Entry
2409              CDS       T30595                                 

Gene name
dnaX
Definition
DNA polymerase III
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Best hit
fpla:A4U99_12030 (best score: 48.521)
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.2409-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_634:2962..3057
AA seq 32 aa
MMAYQALYRRWRPRTFEAVVGQSAICDTLRNS

KEGG   T30595 (Metagenome): 6226
Entry
6226              CDS       T30595                                 

Gene name
dnaX
Definition
DNA polymerase III, subunit gamma and tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Best hit
ppe:PEPE_1484 (best score: 482.641)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.6226-T1-C
LinkDB
Position
C128109:1045..2826
AA seq 593 aa
MAYQALYRKWRPRTFDSVVGQEAITDTLKNAIIRNKVSHAFLFAGPRGTGKTSCAKIFAK
ALNCLNLQDGEPCNECENCKAADSGAMPDIIEIDAASNNGVDEIREIRDKVKYAPTQGKY
KVYIIDEVHMLSIGAFNALLKTLEEPPEHVVFILATTELQKVPATIISRTQRYNFKRISK
QNLVDRMKFILEQENIPYEDSALQVIAQVADGGMRDSLSILDQLLSFEKEKVEYKDALNI
TGYAARETTEQLFLNLLNQKVSESLDLSHKLLQDGATAKNLLSELISLATETMLVLKANK
DSEFLTKDFTNQITTVPEKRYFQLITAANEALNDLRFTNQEEIPLDVFLVKVANPIEESG
EEKADSHNAEINPAINQELSDLKAQVVALAKKVSQTNGFASSNQVFKIDDAKKKNESPKA
SEPQAKPKPKRKKPVNSELNRQAVYAVLEKATKKDLEDVRNVWPDLQSVLGVSEQALLKV
LEPVAASHNRVVMKCKYAFWFERTSENTNLMATLNSELAKFLKHDSEIVLVPDADWLQVR
KDFLAKHKDEILARQKQGNAEIEVDQHQEDDQEKQVIDKAKEIFGSDNINVKD

KEGG   T30595 (Metagenome): 1948
Entry
1948              CDS       T30595                                 

Gene name
dnaX
Definition
DNA polymerase III, subunit gamma and tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Best hit
ppe:PEPE_1484 (best score: 317.39)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.1948-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_525:3..1448
AA seq 481 aa
EIRAIRDKVKYAPTQGYYKVYIIDEVHMLSIGAFNALLKTLEEPPEHVVFILATTELQKV
PATIISRTQRYNFKRISNDQLVNRMKFILDQEKIAYDEKSLQVIAQVADGGMRDSLSILD
QILSYDQAKINYKDTLAITGYADQVKIEALFLDLLNKKTSQALEEVEELLNNGASAKNIL
DEIINLVVKAMLAIKGDTTVTFLSANYLEQLRLISTQVLSQTLQLANDALNSLRYTNQQQ
IPLKVFVVRISTQDVNATGSQNDAAEIKQLQTKVEQLSLQVAELLKKANTSAIAKPSEIL
TEIKDKVRPTKAVNPSVATLKKKKTGLQLSTEANLKKVNVVLSQATKQDLNTIKDVWQQD
MSSLLEVSQRALLEVLEPVAASPTQVVLKCKYEFWFERAMADENFITQLENNLEKLTQHK
YQIVLVSENSWTTIRQEYVKKYKEHLIIAQKELASNPNEEVIKKAKSLFGDLVNVKDDSD
L

DBGET integrated database retrieval system