KEGG   T30595 (Metagenome): 3459
Entry
3459              CDS       T30595                                 

Definition
beta-lactamase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Best hit
lpl:lp_3189 (best score: 289.271)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.3459-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_903:complement(2062..3330)
AA seq 422 aa
VKRFFKTIICLLSFLLISSLALTGGTVFASTSINNVNANEAKLNVKAAITIDQKTGEVLY
AKNAAKALPIASMSKLITIYLTLQAIKNGKLSWNQKLTPTKNIVKLSNNSDYSNVPLQEK
HQYTVKQLYEASLIESANGAVMMLAQAVYGSQENAVNQMRTLLKKWQINGAQIYTTCGLK
NGEVGSDAYPGAGKNVENEVPAVGVAKIVDHLLTDYPEVLSTSKLAELDFKDGSTVTKMK
NWNWMLKGLSQYDSEYPLDGLKTGTSEKAGACFAGTLKYKGRRLITIVMGAKHVDGTDPS
RFVQTKKMLDYVYSNYQLYIYKKGTQLANLKGVKVADGNQKISNLVVKKDSGIWQKTSST
GKLTFSKSEIEAPIKKGQLAGYYLFTNNPSIYSSKGTKLAATVRENIDQANIFVRIWHLF
FK

KEGG   T30595 (Metagenome): 5625
Entry
5625              CDS       T30595                                 

Definition
serine-type D-ala-D-ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Best hit
bsu:BSU00100 (best score: 122.864)
Taxonomy
Firmicutes - Bacilli [GN:bsu]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.5625-T1-C
LinkDB
Position
C127235:1..735
AA seq 244 aa
KMKVVAKRAGVKNPEIYNMIGLSNGELGDLKLPKIDDNQENQFSAKDMALVSKYLIDKYP
EVLNITKTKYANFKIRQDNEMKMENIIYMLEGMGYGPKKGTMDGLKTGKTDAAGYCYVGT
GTFDNRRVITVVLDVPGEYSNQFIQTNNMIDTVFDKYQLVKVDKNNLPKKYQKITITSKK
QKKKISVVPEKDSALWLQKKQNLSSLTPKLIVKEQNKVKKGSIVAKLVYKLDKRNSVKIN
LIRK

KEGG   T30595 (Metagenome): 4786
Entry
4786              CDS       T30595                                 

Definition
serine-type D-ala-D-ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Best hit
bon:A361_00085 (best score: 105.145)
Taxonomy
Firmicutes - Bacilli [GN:bon]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.4786-T1-C
LinkDB
Position
C125088:163..630
AA seq 156 aa
MKRFWDKLGLAGIVVLWIIGIINLSFFNIVKADVQSVNAKAAFMMDEKTGQILYQRNATK
KYAVASLTKILTLAVIMEDIHKHKLDWDQEIQISKDVAKVADDWHFSNVPLVYNERYTVR
SLIESMMIVSADGSTEALALADAGSVAAFNYKMKVV

KEGG   T30595 (Metagenome): 2120
Entry
2120              CDS       T30595                                 

Definition
beta-lactamase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Best hit
bsu:BSU00100 (best score: 217.238)
Taxonomy
Firmicutes - Bacilli [GN:bsu]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.2120-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_567:11917..12843
AA seq 308 aa
MRHAKKKSKKNFLWIIGIVVIAICFLLWKNNFGPNSMPSNYHANQVDLNVKSAVAIDAKN
GNVIYAKNANQSLPIASMTKLLTAYLTLKAIKEKKISWDTTVSPTQEIINLGSNPDYASV
PLNLGQKYTVKELYDAALIKSANNAARMLAIAVSGNETNFLNQMRQQANKWKLHNVKFVT
VDGLPEKKKNFLGMTTTIENKMSANDMAIIARKLVTDYPEVLNTTKVAKTYFRNTLMTNS
NKMLNGLSDYDPNYPVDGLKTGTTDGAGSCFTCTVDKNNKRVITVILGAQNDNERFSETK
KLLNYSFN

KEGG   T30595 (Metagenome): 2201
Entry
2201              CDS       T30595                                 

Definition
serine-type D-ala-D-ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Best hit
efc:EFAU004_01934 (best score: 207.608)
Taxonomy
Firmicutes - Bacilli [GN:efc]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.2201-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_592:complement(1908..2909)
AA seq 333 aa
LLTIYLTLKAIKAGKLSWQTKVMPSREAIAVSKNPEYSNVPLQLGHQYTIRQLYQATLIQ
SANGAAMVLASAVAGSSKKFVGMMRKQLLDWHISQAQIVTPSGLPNFTLGRDADSTKNAD
AENELSASDMGILIKHLLLEFPQVLDTTRISKLNFPDGRNTFKMVNWNLMLKGLSQYNEA
YPVDGLKTGTTDAAGACLASTLVKNGRRIVTVIIGARHLNGNDPARFVETKKLYAYFYNN
YSLHIYKRWTQFPGKTLIKVKNSPINEVRACLYQDTGIWISKGQKLDAELSMNKMPMPIK
VGTNIGKLIFPNIPALNNENALAFDATTSQELK

DBGET integrated database retrieval system