KEGG   T30595 (Metagenome): 3606
Entry
3606              CDS       T30595                                 

Gene name
dnaE
Definition
DNA polymerase III, alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Best hit
lpl:lp_1899 (best score: 870.922)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.3606-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_932:15620..18736
AA seq 1038 aa
MGTVSLQNLSSFTLLESPTKVKDLAENAKKKGYSALALTDVNITYGLVNFYKAAKETGIK
PLLGMQLRINGLIDQANKYDLIVISKDDQGYKNILRLSSAVNLLTENGEKENVLELEELK
KYLGHLVIITPSNLHSELKMLQTNNPNMGANYVRILKDAVPTSSLVYLGVYADQGQQEYI
NYLRSLATQFELSLAAVEDGQYLNRNEQFLRRTLQAIKSNTHLENVEQLAKQAGSHYLKT
SEELQVNYRKFEIEDALENAEKIGQLCNAKITFQDPQLPKFKQNKFPTSKEYLHSLAQNG
LAKRFKGQIPERYQKRLDYELKVINEMGFDDYFLIVWDVMNFAHSVHITTGPGRGSAAGS
LVSYALRITEVDPLEYNLLFERFLNPARQQMPDIDLDIPDNRRDEVIKYMFEKYGMNHAA
QILTFGTLAAKQVLKDVCRVFGLNKVETYRWLDAIPHAKGKITLAEAYQKSKELQLLVNT
NTFSKILFATAEHLENLPRHYSIHAAGLVITDDSLAEIVGLQAGPLGIPVTQQTKLNVES
LGLLKIDFLGLRNLTILGNIIAALKSEGVEIDPNQIPLNDQETLALFQRGDTDAVFQFES
DGIKRVLEQLHPDSFEDIVAVNALYRPGPMNNIGHFINRKHGKERVQYPDPSLKKILGPT
YGVLVYQEQVMQTAQVLAGFSLGEADLLRRAMSKKNADVIQKEREKFIQGAVKLGRRKEV
AEQVYDYIAQFANYGFNRSHAVAYSKIAFWLAYFKVHYPGAFYLSLLNSNIGNRNKIAQY
LMQAQEAGLKTLPPDIENSQADFSLENGKILVGLKAIRGLRSDLLKQILEIKRPIKSMTD
FLWKIDNNLLSADAIANLIKAGAFDRLAPNRNELLKINKDLVESVKMAGSNLSLFETLEP
KIEEEKMPTAAEKSAMEVEAMGFSTGINPIIAVQKYARKYNAKRLQAFESNEQGIAVGKL
MRIKQITTKKGDNMAFAVFSDSSGDKDFTIFPQVWKKVEENLKIGDIYLLQVKTQSDRFS
PTKTQFLLSNARKVNFKD

KEGG   T30595 (Metagenome): 2542
Entry
2542              CDS       T30595                                 

Gene name
dnaE
Definition
DNA-directed DNA polymerase III alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Best hit
ssm:Spirs_1327 (best score: 137.117)
Taxonomy
Spirochaetes [GN:ssm]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.2542-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_701:3..419
AA seq 138 aa
PIKNIDSYIRRKNKEEKVVYPDPVLINLLKPTYGIIIYQEQVMKTAQIYAGFSLGEADLL
RRAISSKDSIEMKKIGVDFVNRAVKQGHSASAASSIFEYILKFSNYGFNKSHSVAYSKMS
YLXXXXXXXXIYYGSETR

KEGG   T30595 (Metagenome): 5698
Entry
5698              CDS       T30595                                 

Definition
DNA polymerase III subunit alpha
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Best hit
lpl:lp_1899 (best score: 186.037)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.5698-T1-C
LinkDB
Position
C127367:931..1803
AA seq 291 aa
MQVSGLQTLSSFSLLKSPILVDELVKDAVDKGYSSLALTDINVTYGLVDFYLAAKKANLN
PLLGMTIRLNGMIDQAHRYDLISIAKNNEGYKNLLRLSSAINLKTDNGDERKVLTLKQVA
KYLSDQIFIIPANVTSELRYLSENNEKLGSDYLRELQKIIPSSSDLYLGVYASKNQPYIN
YVKALAAQFNLPLAAAEDVQYLQASDQFLVKTLRAIEQGQKLVDTSSLALQKGSHYLRSS
GELVAAYNENGIIEALHNAAKIADECKAEVIFTQPELPRYRQNFAPSSKIY

KEGG   T30595 (Metagenome): 4492
Entry
4492              CDS       T30595                                 

Definition
DNA polymerase III subunit alpha
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Best hit
efa:EF1044 (best score: 199.519)
Taxonomy
Firmicutes - Bacilli [GN:efa]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.4492-T1-C
LinkDB
Position
C123642:3..452
AA seq 150 aa
GRGSAAGSLVAYSLAITEVDPIKYNLLFERFLNPARAQMPDIDLDIPDNRRDEIIKYMFE
KYGMDHAAQILTFGTLAAKQALRDCARVFGLTTVQASKFTHAIPFSKVKITLSQAYQESK
ALQLLVNASELNKLLFRTAMRLEGIPRHAS

KEGG   T30595 (Metagenome): 5454
Entry
5454              CDS       T30595                                 

Gene name
dnaE
Definition
DNA polymerase III, alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Best hit
vte:BHY08_06275 (best score: 433.721)
Taxonomy
Firmicutes - Bacilli [GN:vte]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.5454-T1-C
LinkDB
Position
C126919:complement(1..1338)
AA seq 446 aa
PRHASIHAAGLVISDKSIAQIAGLQAGTLGIPVTQQTKAHVEELGLLKIDFLGLRNLTIL
GETVELLAKDGIKLDPKQIPLNDAKTLQLFQKGQTDAVFQFESQGIKNVLKRLHPDSFED
VVAVNALYRPGPIQNIDHFINRKQGKEAITYPDSSLAQLLKPTYGILVYQEQVMQTAQIM
AGFSLGEADLLRRAMSKKKQDLIDQEREKFITGAVKNGHPQATASKVYAYIEQFANYGFN
RSHAVAYSKIAFWLAYLKVHYPAAFFTALLNSVSANRIKAGEYITQAQEVGVKILPPDIN
QSQTDYSLLNGQIQVGLKAIKGIRVDFLKNIANLPKNFSSLADFLRKIDAKFLSEQTIAA
MIKAGCFDKIDKNRKMLLLNCKEIVENIKFTGQNETLSEGLGGIRLEQAPAPNANEKATM
EEEVLGFSTTKTPILVVQKYAERFNA

KEGG   T30595 (Metagenome): 2543
Entry
2543              CDS       T30595                                 

Definition
DNA polymerase III subunit alpha domain protein
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Best hit
vte:BHY08_06275 (best score: 93.2041)
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.2543-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_701:343..1050
AA seq 236 aa
LLIVKCHIYXXXXXXXKYIMDLKLDNIKITLPDINYSKRNFYISDKGEIVTGLNSILGLR
MDFVEQIMNLQRPIKSLTDFLWKIDTKYLSPDMIGNLIKSGAFDKLHKNRSALLASYKDL
LVCIKMSGGNNVLFQALEPKELDIKMPSNAQKEEWETSVLGFSPQIDPILAAQIYAKKYG
FKPFSDFTFYDEGVSVGKMMDIKVITTKNNKKMAFAKFNDLHETVDFVIFPAVYES

KEGG   T30595 (Metagenome): 4337
Entry
4337              CDS       T30595                                 

Definition
DNA polymerase III subunit alpha
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Best hit
prd:F7984_15200 (best score: 62.7734)
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.4337-T1-C
LinkDB
Position
C122936:complement(98..400)
AA seq 100 aa
RFNAQTLNSFTVNETGIAVGKLIKLKLIRTKKGDTMAFSTFRDASSEQEITIFPGIYSKI
SDILKEGQIYLLGIKTQSDRYDAGKVQYMLTNLKLVNFTE

KEGG   T30595 (Metagenome): 3896
Entry
3896              CDS       T30595                                 

Gene name
dnaE
Definition
DNA-directed DNA polymerase
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Best hit
tmr:Tmar_0370 (best score: 57.7658)
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.3896-T1-C
LinkDB
Position
C121228:1..315
AA seq 105 aa
QAIDANTQLENVEEKAKELGKNYLQPQADVLGAYQAVDLEQAAEKTVEIAAKCNIDFEFK
QPILPHFDTPTGKSSAEYLRYLCIEGLKKRQIAPGLKLTDYQQRL

KEGG   T30595 (Metagenome): 1089
Entry
1089              CDS       T30595                                 

Gene name
dnaE
Definition
DNA-directed DNA polymerase III alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Best hit
lme:LEUM_0774 (best score: 60.8474)
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.1089-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_220:488..919
AA seq 144 aa
MEIAGLQNISSFTLLKSPISIXXXAKSEGIKPLLGMQLRINGLINENQNFDLIVIAKNNV
GYQNIMRLSSAVNLITENGKKEIDVTLNKLQKYLGNLHIITTANQHSELRDLFYHNFDLM
PDYIRKLAKILPQSSNLYLGVFAD

KEGG   T30595 (Metagenome): 1169
Entry
1169              CDS       T30595                                 

Gene name
dnaE
Definition
DNA-directed DNA polymerase III alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Best hit
aur:HMPREF9243_1374 (best score: 229.95)
Taxonomy
Firmicutes - Bacilli [GN:aur]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.1169-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_258:1..672
AA seq 224 aa
DSNVEIKFTMPQLPKFIQHKFDTSYEFLHHLAMTGLQAKFNKHDIPAKYLNRLKYELKII
DEMGFNDYFLIVWDVINYCHSIGILTGPGRGSAAGSLVAYCLNITRVDPLRYDLLFERFL
NPARQQMPDIDLDIPDNRRNEVVLYMFHKYGMDHVAQILSFSTFAAKQVLHDVGNAFSFN
KITINSWQKAIPKSKSKITLSDAYKLSKDFRMLVNATESNKLFF

KEGG   T30595 (Metagenome): 4155
Entry
4155              CDS       T30595                                 

Definition
DNA polymerase III
  KO
K03763  DNA polymerase III subunit alpha, Gram-positive type [EC:2.7.7.7]
Best hit
marr:BKP56_08850 (best score: 141.739)
Taxonomy
Firmicutes - Bacilli [GN:marr]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.4155-T1-C
LinkDB
Position
C122214:complement(3..359)
AA seq 119 aa
YKRAKPNHMTVLAINKVGLKNMYKLVSLASTKYFYRLPRTPLSELKRLHEGLLYGSGCLQ
GDVFISMMQKGYDATREKARIYDFLEVQPPAAYQHLLDDKLIKDKKELQEIITNIYKLG

KEGG   T30595 (Metagenome): 5628
Entry
5628              CDS       T30595                                 

Definition
DNA polymerase III, alpha subunit, gram-positive type
  KO
K03763  DNA polymerase III subunit alpha, Gram-positive type [EC:2.7.7.7]
Best hit
lpl:lp_2045 (best score: 794.267)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.5628-T1-C
LinkDB
Position
C127237:complement(43..1629)
AA seq 528 aa
CPKCKYSHFFENGEYGSGFDLPDKKCPECGTELVKDGQDIPFATFLGFHGDKVPDIDLNF
SGDYQPVAHNYIRVMFGPANSFRAGTISTVADKTAYGYAKHFEEERNLNLRSAELDRLAT
GTSGVKRTTGQHPAGIVVVPDDMDIYDFTPVQYPADDLNAAWLTTHFDFHSIHDNILKFD
ILGHDDPTMIRMLQDLSGVDPMTIPPDDPGVMSLFSGTDILGVTPEQIASKTGTLGVPEF
GTKFVRGMLEETNPTTFSELLQISGLSHGTDVWLGNAEDLVNNGTCKLKNVIGCRDNIMM
DLIHWGVKPEVAFSTMESVRHGRGISDDDMAVLKKNNNIPDWYIPSCLKIKYMFPKAHAT
AYILMALRIAWFKVYYPVIYYTSYFSVRADLFDLVAMSHGKNSVKAAIKKIQDQGNDASA
KDKSLLTVLEIANECLERGIKIKMVDVNESEALNFKIVDDHTILAPFNAVPGLGDNAAKQ
IVAARAEQKFLSKEDLRTRGKVSQTIMDYLEVNGVLEGMPDQNQLSLF

KEGG   T30595 (Metagenome): 145
Entry
145               CDS       T30595                                 

Gene name
polC
Definition
DNA polymerase III, alpha subunit, gram-positive type
  KO
K03763  DNA polymerase III subunit alpha, Gram-positive type [EC:2.7.7.7]
Best hit
vte:BHY08_03560 (best score: 1548.87)
Taxonomy
Firmicutes - Bacilli [GN:vte]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.145-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_36:21408..25706
AA seq 1432 aa
VANKNELFKKLLDQIKFPDKFEDNDIVQNGEIENVDVYANERKWKIHVFFDTPLDFETYR
SLNELIHQTFEPFVNVELIVRTKDGSSKNLPEYWTYAIQNSTNLKPAVREFLQGQAPYLE
KEKWLIPTQNNVVNGLLSEQVLAELNSEFRRYGFFNIKFTTKVDETNIDENLKSLEQVQA
QHESAMQEFYEKQPAEPKKKMPVKSTRMGSNKVDKKAKFIQIKDLEDGSGNVAIEGHIFN
TDIHELKSGSVIFTGEITDYTDSISFKKFVSDKEQIDYLKGIKPGVWARMQGYAADDQYQ
HDVVFNIRNLELIEHKGREEKYEGEEKRVELHLHTNMSQLDATSTASDFIKTAKKFGQKA
IAITDHADVQAFPEAYHTGASEKMKILYGYEANMIDDHALLVLNPTEMDYRDREYVIFDV
ETTGLSSVYDTIIEIGAVKMKNGEVLERFDEFINPHHPLSDTTINLTSITDEMVGAADDE
KDVIKKFKDFYGDRPLCGHNVQFDVGFVNAALRRAGLDEISQPVVDTLEVSRLLHPEQTR
HTLDSLAKKYNVVLEHHHRANQDAEATGYLMFKLLDAFNARFHEADLGKMNDYAKYGQVY
KRAKPSHMSVLALNQEGLKNMYKLVSLASTKYFYRIPRTPKSELRKYHKGLLFGSGCWQG
DVFISMMQKGYDEAREKARFYDYLEVQPPAAYQTLIDDDLIKDEDELHEIIQNIYKLGKE
LNKPVVATGDSHYVEPHEAIYRKILLAAQKSNPNRNKKLPDLHFYSTQEMLDAFSFLGED
VAKEIVIENTNKLADQIEEIAPIKSGLYPPHIENADQEMKDLTYNKAYELYGKPLPKIVE
DRIELELNSIISNGYAVIYLISQRLVAKSNKDGYLVGSRGSVGSSLVATMSGITEVNPLA
PHYRCPKCKYSKFFENGEYGSGYDLPDKNCPKCGTPLVKDGQDIPFATFLGFHGDKVPDI
DLNFSGDYQPVAHNYIRVMFGPDNSFRAGTIATVADKTAYGYVKHYEDENELHLRNAELD
RLAAGASGVKRTTGQHPAGIVVVPDDMDIYDFTPVQYPADDLSAAWLTTHFDFHSIHDNI
LKFDILGHDDPTMIRMLQDLSGIDPLTIPPDDPGVMSLFSSPKILGVTPEQIQSKTGTLG
VPEFGTKFVRGMLEETKPTTFSELLQISGLSHGTDVWLGNAEDLINNGTCKLKNVIGCRD
NIMMDLIHWGVKPEVAFFTMESVRHGKGISDENMEILKKNDKIPDWYIPSCLKIKYMFPK
AHATAYILMALRIAWFKVYYPVIYYASYFSVRADLFDLVAMSHGKNTVKAAMKEIQDKGM
DVSAKDKSLLTVLEIANECLERGIKIKMVDVNESEAMDFKIIDDHTILAPFNAVPGLGDN
AAKQIVAARAEQKFLSKEDLATRGKVSQTIMEYFENNGVLEGMPDQNQLSLF

KEGG   T30595 (Metagenome): 2681
Entry
2681              CDS       T30595                                 

Definition
exonuclease, DNA polymerase III, epsilon subunit family
  KO
K03763  DNA polymerase III subunit alpha, Gram-positive type [EC:2.7.7.7]
Best hit
nmk:CHR53_09700 (best score: 375.17)
Taxonomy
Firmicutes - Bacilli [GN:nmk]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.2681-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_734:complement(2..1393)
AA seq 464 aa
TCQNNFVQSMFTSEVLDAIASEFNKYGFKDLSFNINLEDNTKEDIKQLKQQQLEHENAMQ
KMYEQSPEQSQEYSPEYNPEHNMEITKIKDLEDGNKDIFVEGHVFNVESRELKSGKVILT
GEITDYTDSISFKKFLSSKDKLADLEDIKPGVWVQIQGNVLDDTFQHEIVLNIKSIKLIK
HIGRQETYEGKQKRVELHLHTNMSQLDATNSAGDFVKAAKKFDQKAIAITDHADVQAFPE
AYVAGKKNGLKIIYGYEANMINDQALLVLNPANMDYRGQEYVIFDVETTGLSSVYDTIIE
IGAVKMKDGVVIDRFDKFINPHHLLSDTTINLTSITDEMVQNADDENIVIRQFQEFYQDL
PLCGHNVQFDIGFLNAALRRCNMDIITQPVVDTLEVSRLLHPEQTRHTLDSLAKKYNVVL
EHHHRANQDAEATGYLMFKLLDAFYERFQEANLGKMNDYAKFGQ

KEGG   T30595 (Metagenome): 6037
Entry
6037              CDS       T30595                                 

Definition
exonuclease, DNA polymerase III, epsilon subunit family
  KO
K03763  DNA polymerase III subunit alpha, Gram-positive type [EC:2.7.7.7]
Best hit
vte:BHY08_03560 (best score: 751.125)
Taxonomy
Firmicutes - Bacilli [GN:vte]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.6037-T1-C
LinkDB
Position
C127849:42..2774
AA seq 911 aa
VADSNKLFLRFLKQIKFPNSFSDNDLLVKGKIENVDVYGKKRKWDIHVFFDTPLKFDTYE
ALVKLAEQEFSPFIDVNIMISTADGSDNYLPEYWSYVVSQTENMSAMARECLSSKKPVKV
ASDWIIEVETPMLANAISQSDLDNLSFDLRKYGFFNIKLKLQVKNANEDANLASLEQLEQ
LQAEHEKSMNEAFKNIPAKPKRVVQSSTRQTREKNFGKADIPASEVIGMKEIEDGMRNIA
IEGNIFNIDSHELKSGAFIFSGEITDYSDSIAFKKFVKDKEQIEMLKGIKPGVWARMSGS
ALDDQYVHDVVFNINNFKIVEHVGRTEKYQEEPKRVELHLHTIMSQLDATNTATDFISTA
KKFGQKAIAITDHGDVQSFPEAYSAGKKQKMKILYGLEANMVDDHALLVLNPASMTYENR
EFVIFDVETTGLSSVYDTIIEIGAVKMKDGEVIERFDEFINPHHPLSETTINLTSITDEM
VSKADDEAEVIKRFQEFYGDRPLCGHNVQFDVGFVNAALRRSGLKEITQPVVDTLEVSRL
LHPEQTKHTLDSLCKKYNVVLEHHHRANQDAEATGYLMFKLLDAFNDKFEQDDLGKMNDY
AKFGQVYKRAKPTHMTVLALTQKGLKNMYKLVSLASTQYFYREPRTPISELRKYREGLLF
GSGCWKGDVFITMMQKGYDEAREKARFYDFLEVQPPAAYSQLIADELIKDEEQLEEILKN
IYKLGQELNIPVVATGDCHYLNPEDKIYREILIAAQRSNPNRNKPQPKLHFYSTQEMLDA
FNFMGEDVAKEIVIDNTNKIADEIEEIAPVKSGLYPPHIKDADQQMTDLTYNKAYELYGK
PLPKIVKDRIELELNSIISNGYAVIYLISQKLVAKSNKDGYLVGSRGSVGSSLVATMSGI
TEVNPLAPHYR

KEGG   T30595 (Metagenome): 2327
Entry
2327              CDS       T30595                                 

Gene name
polC
Definition
DNA polymerase III, alpha subunit, gram-positive type
  KO
K03763  DNA polymerase III subunit alpha, Gram-positive type [EC:2.7.7.7]
Best hit
vte:BHY08_03560 (best score: 927.546)
Taxonomy
Firmicutes - Bacilli [GN:vte]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.2327-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_610:complement(543..2621)
AA seq 692 aa
TNIYKLGKELGIPVVATSDAHYIDKKDAIYRKILLSAQKANRGKNYELPDLHFYTTQEML
DAFSFLDPKIAEEIVIKNTNIIADKIENVEPIKSGLYPPHIENADKEMEQLTYDKAHELY
GNPLPKIVKDRLEYELKSIISNGYAVIYLISQRLVAKSNKDGYLVGSRGSVGSSLVATMS
GITEVNPLAPHYRCPNCKYSQFFEKGEYGSGYDLPDKKCPKCNADLAKDGQDIPFATFLG
FHGDKVPDIDLNFSGDYQPVAHSYIRVMFGPDNSYRAGTIGTVADKIAYGYVKHYEDENE
LKLRNAELDRLSQGASGVKRTTGQHPAGIVVVPNDMDIYDFTPVQYPADDLDAAWLTTHF
DFHSIHDNILKFDILGHDDPTMIRMLQDLSGVDPLTIPPCDPGVMSLFSGTDILGVTPEQ
IGVNTGTLGVPEFGTKFVRGMLEETKPTTFSELLQISGLSHGTDVWLGNAEDLINKGICK
LKNVIGCRDNIMTDLIHWDVPPEVAFSTMESVRHGKGISDENMAILSKNKNIPDWYIQSC
LKIKYMFPKAHATAYILMALRIAWFKVYYPVIYYTSYLSVRADLFDIVAMSHGKNTVKAA
MKKIRDQGNNASTKDXXXXXXXXXHNILAPFNTVPGLGDNVAKQIVAARDEQPFLSKEDL
SIRGKVSQTIMEYFENNGVLDGLPDQNQLSLF

DBGET integrated database retrieval system