KEGG   T30595 (Metagenome): 4106
Entry
4106              CDS       T30595                                 

Definition
hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Best hit
btab:109030380 (best score: 35.8094)
Pathway
00071  Fatty acid degradation
00072  Synthesis and degradation of ketone bodies
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00362  Benzoate degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
00900  Terpenoid backbone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
02020  Two-component system
04975  Fat digestion and absorption
Other DBs
HMP: SRS047335.4106-T1-C
LinkDB
Position
C122010:complement(285..350)
AA seq 21 aa
GVASLCVGGGMGIAALVSLPN

KEGG   T30595 (Metagenome): 1056
Entry
1056              CDS       T30595                                 

Definition
acetyl-coA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Best hit
ljo:LJ_1609 (best score: 428.713)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00071  Fatty acid degradation
00072  Synthesis and degradation of ketone bodies
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00362  Benzoate degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
00900  Terpenoid backbone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
02020  Two-component system
04975  Fat digestion and absorption
Other DBs
HMP: SRS047335.1056-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_207:818..1993
AA seq 391 aa
MLFNNXXXXXXXXRTPFGKFRGFFSDQNPIDMASQLLSKMLSKNKLPKKQIEAVYIGNVC
STGLGQNPARQVALHCGLSQETISTTINDVCGSSLKAMRLAQAQMQIGDFDMVAVGGVEN
MTQAPFFVESQFKDHSQDHLQWTLMHDCLNDAFSHQAMGITAEMVAQAHKISRDAMDQYA
YESHQKAIKAIKNDWFAQEIIPFKKENETLVNDENVRFDTSLEKLAKLRPVFMENGTVTA
GNSSPLSDGASFLILATGDKVKELKLKPIAKLGQFIEIGCDPNYMGYGPYYAIRKLLNKT
NTTIDDYDVIEINEAFAAQIVAVARDLKIPNNKLNIAGGAISLGHPLGATGTRLVATAIN
NLHQVSGHNALVSLCIGGGQAIACNIECVTK

KEGG   T30595 (Metagenome): 6256
Entry
6256              CDS       T30595                                 

Definition
acetyl-coA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Best hit
ljo:LJ_1609 (best score: 394.43)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00071  Fatty acid degradation
00072  Synthesis and degradation of ketone bodies
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00362  Benzoate degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
00900  Terpenoid backbone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
02020  Two-component system
04975  Fat digestion and absorption
Other DBs
HMP: SRS047335.6256-T1-C
LinkDB
Position
C128131:complement(1837..2997)
AA seq 386 aa
MRGNLMQDIYIIAAKRTPFGRYRGQLAAFNAVELGTYALKDALKAANLRSSDLDALFMGN
VLSAGLGQNMARQVAINSGMREESVATTINEVCGSSLKAVRLAQAQMLIGDLDLVAVGGS
ESMTNAPLLAKKSEKDNPNFVDSMLNDGLTDSFSNKLMGNTCENVAVKYGISRAEADEFS
VNSHQKAARAQAAGFFNQEITPLAELDHDENVRPDSNVEKLASLKTVFKEGGVATAGNSS
PLSDGASMLILATEDKVKELNLKPLAKLTAYAEVGLDPQIMGFGPKVVIEKLLQENGQTL
ADIDLFEINEAFAATSLAVEKELHLDHSKVNIHGGALALGHPLGASGARILGTLAHSLIS
ENKERGIASLCIGGGLAIAFEIERGK

KEGG   T30595 (Metagenome): 206
Entry
206               CDS       T30595                                 

Definition
acetyl-coA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Best hit
ljo:LJ_1609 (best score: 691.419)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00071  Fatty acid degradation
00072  Synthesis and degradation of ketone bodies
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00362  Benzoate degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
00900  Terpenoid backbone biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
02020  Two-component system
04975  Fat digestion and absorption
Other DBs
HMP: SRS047335.206-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_40:30406..31572
AA seq 388 aa
VLQDVYIVGMNRIPFGKYRGFYKDENAVDLGVLALKGLLKKNIVAQDKIDNILIGNVLSA
GLGQNVARQIALKSGLPESVVATSVDDVCGSSLKALRLAQGQMLLGDSEIAVVGGAESMT
NAPLLLNKSNKHDENPVYRDSLMIDGIGDAYSEKPMGITAENVADKYQVTRQDMDEFARD
SHAKAYAAQENNWFEEEYTPVKLNEKVLDHDETIRPDTSLDALGQLKPVFKENGRVTAGN
SSPLTDGASMVLLANQQKLDDLDLTPLAYLGAYAEIGCDPAYMGYAPYFAIEKLLKETNS
TIDDYDLVEINEAFAAQAYAVARDLDIPKEKLNIAGGAISLGHPLGATGTRLVISAVNSL
RKINGRRAIVSLCIGGGQGIAYEIRRII

DBGET integrated database retrieval system