KEGG   T30595 (Metagenome): 4291
Entry
4291              CDS       T30595                                 

Gene name
lacL
Definition
beta-galactosidase large subunit
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Best hit
lpl:lp_3483 (best score: 191.045)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
00052  Galactose metabolism
00511  Other glycan degradation
00600  Sphingolipid metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS047335.4291-T1-C
LinkDB
Position
C122750:complement(3..389)
AA seq 129 aa
VDFDASNFDQIEVPSEIELSDYAQNNYINTLIPWEGKIYRRPAYALSQDDPEEGSFSEGA
DNTVGLYLKRFDLNDELRGKQIRVRFEGVERSMYLWLNGHFIGYAEDSFTPSEFDLTPYI
QDEDNVIAV

DBGET integrated database retrieval system