KEGG   T30595 (Metagenome): 4475
Entry
4475              CDS       T30595                                 

Gene name
lepB
Definition
signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Best hit
wko:WKK_03835 (best score: 149.058)
Taxonomy
Firmicutes - Bacilli [GN:wko]
Pathway
03060  Protein export
Other DBs
HMP: SRS047335.4475-T1-C
LinkDB
Position
C123570:2..400
AA seq 132 aa
VDPQVATKTDYVKRVIGVPGDTVRSANGNIYVNGRKVNQNYINNTQRTSGTGNWTLKSIS
VQNNWLRDSGATKVPKGQYFVLGDHRSVSNDGRYWGFVPKSKIDGVVKVPSWTGTATTRY
NVNQEWKHYWAN

KEGG   T30595 (Metagenome): 2256
Entry
2256              CDS       T30595                                 

Gene name
lepB
Definition
signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Best hit
efa:EF1111 (best score: 150.214)
Taxonomy
Firmicutes - Bacilli [GN:efa]
Pathway
03060  Protein export
Other DBs
HMP: SRS047335.2256-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_603:complement(20090..20659)
AA seq 189 aa
MSKHKTESAESLGHWLLQVFILAIVIFGLYIFMFRVLLANETITGPSMQPTFENNDRIIA
VRHSKLSRGDIVILRAPDQPGALYIKRIIGVPGDSIKSKNDVMYINGKPIKEPYLTKYKK
KLAKGQLYTNNFNLQQLYHVKRVPKDCYFVMGDHRNISKDSRMIGFIKRKDIVGEVKLRY
FPFDQIQWF

KEGG   T30595 (Metagenome): 126
Entry
126               CDS       T30595                                 

Gene name
lepB
Definition
signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Best hit
dpm:FNV33_05150 (best score: 135.576)
Taxonomy
Firmicutes - Bacilli [GN:dpm]
Pathway
03060  Protein export
Other DBs
HMP: SRS047335.126-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_36:complement(3634..4284)
AA seq 216 aa
VKKLKKQEQTESWGQWILQVLILVAIFFGIFFVLNKFVFANLTVSGISMQPTFENNDRVI
ALRHAKIKQGDIVIVDAPDEPGALYIKRVIGLPGDTVVSKNNQIYINGKKINQPWLKAGQ
KLIDNGEDGISGTKYTNTQNFTLSSLAKTQDYRQFYTSKQLKEMQKTNKVPANTYFVMGD
HRSVSKDSRYIGTIPRSKIVGVVKMRYWPLNHITFY

KEGG   T30595 (Metagenome): 606
Entry
606               CDS       T30595                                 

Gene name
lepB
Definition
signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Best hit
efa:EF1111 (best score: 157.147)
Taxonomy
Firmicutes - Bacilli [GN:efa]
Pathway
03060  Protein export
Other DBs
HMP: SRS047335.606-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_110:complement(3314..3916)
AA seq 200 aa
MNNYQAKHASNNQKDEPKAVPFYKSCLQVIFLSAIFLGCYYLLFTFVLANESVSGLSMQP
TFENNDRLIAVRHTNLQRGDVVILKAPDNPGAFYIKRIIGMPGDTVSSKNDITYINGKPL
REKYLDEYKNSLPKGQLYTNNFSLKKLFNVSRVPKNSYFVMGDHRNISKDSRIIGFIKKK
DIVGEVKLRYFPINKIQIFK

KEGG   T30595 (Metagenome): 5239
Entry
5239              CDS       T30595                                 

Gene name
lepB
Definition
signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Best hit
stea:C0679_11130 (best score: 166.392)
Taxonomy
Firmicutes - Bacilli [GN:stea]
Pathway
03060  Protein export
Other DBs
HMP: SRS047335.5239-T1-C
LinkDB
Position
C126506:3..521
AA seq 172 aa
QVFVMAAILLGIYYLIFSFVLSNETVSGPSMQPTFENGDRIIAVRHTSLKRGDIVILNAP
DEPGALYIKRIVGMPGDSITYKNDQLYLNGKKYSEPYLTEGKKLYANGQLYTENFSLKSK
FGVNKVPSGEYFVMGDHRNVSKDSRYFGFVKRKAIVGKVIFRYWPLTKWSTF

DBGET integrated database retrieval system