KEGG   T30595 (Metagenome): 4604
Entry
4604              CDS       T30595                                 

Gene name
uvrC
Definition
uvrABC system protein C
  KO
K03703  excinuclease ABC subunit C
Best hit
ppe:PEPE_1135 (best score: 77.7962)
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.4604-T1-C
LinkDB
Position
C124198:3..191
AA seq 62 aa
RQTHAKNSLSSKLDGIKGIGPKSRNKLLKKFGSLKKIKDASIEELQDAGLTLPQAQSVKL
TL

KEGG   T30595 (Metagenome): 3597
Entry
3597              CDS       T30595                                 

Gene name
uvrC
Definition
excinuclease ABC, C subunit
  KO
K03703  excinuclease ABC subunit C
Best hit
lpl:lp_2109 (best score: 806.208)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.3597-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_932:6091..7893
AA seq 600 aa
MATEHIENKLKLLPDKPGCYLMKDINGNVIYVGKSKNLKNRVRSYFKSKQVGRRAELVRE
IRDFDIITVSSDKESFLLEITLIKKYQPYYNVQLKQGTGYPYIEITNERDPQTRLTSFVH
KDHGYYFGPYPNVYAAQATLKFIQKVWPLRRCSGHQGRPCLYYHMGQCLGACFKEVPKSA
YDKQIRKIKRFLNGDISQVKQDLTEKMTQASMNLEFERAAEFRDQLKYIEQTVEKQKIIS
NDHTQRDIFNFYVDKSWISIQVFFLRQAKLLRRETRLFPLTDTNEPQDAFVSFIAQFYGQ
RNRVLPKEVLVPAGIDNEALAEVLGVAVRTPQRGQKRALLEMAHDNAKLKLDEKFRLLEL
GNRKTKGAQKEIFDALGLPYGHRIESFDHSHIQGADPVSALVVFTDGEPDKHEYRKYKLK
GEVEHQNAADEVGNTREVVRRRYSRLLKEHKKMPDLILMDGGQIQVDACLDVLRNELNVN
IPVAGMVKDDHHRTNHLIFGDPTQGEELKLIPLNPKSEGFYLMTRIQDEVHRFAITFHRR
THAKNALSSKLDEIKGIGPKSRNKLLRKFGSLKKIKEASIEELRDAGLTLPQAQTVKLSL

KEGG   T30595 (Metagenome): 992
Entry
992               CDS       T30595                                 

Gene name
uvrC
Definition
excinuclease ABC, C subunit
  KO
K03703  excinuclease ABC subunit C
Best hit
ppe:PEPE_1135 (best score: 666.766)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.992-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_174:complement(1235..2956)
AA seq 573 aa
MANQNIENKLKLLPDCPGCYLMKDLNGKVIYVGKSKNLKNRVRSYFKSKQVGRRAELVRD
INDFEIIVVSSDKEAFLLEITLIKKYQPYYNVQLKNGGGYPFIEITNERDPEVKLTSIIK
KDKGYYFGPYPNVYAAQATLKFIQKMWPLRRCSGKLGRPCLYYNMGQCLGSCFKKVSSDK
YDHQIKQIKCFLNGDITKAKTELIKKMQIASDNLEFERAGEYRDQLSYIEQTVEKQKIML
HDKLQRDIFNFYVSQGWISIQILFIRQSKLMRRETKIFNLTDIDKAKDEFESFIVQFYNA
KNRLLPNEILVPKGVNASSLAAVLKVRVKTPSXXXXXXXXFNALGLPYGSRIESFDHSHI
QGTDPVSALVVFIDGMPAKHEYRKFKLKGEIEHQNGADEVKNTREVVRRRYSRMLKEHLV
LPNLILMDGGKIQVDACLDVLRNELNVNIPVAGMVKDNCHRTNHLIFGDPTVGEELRTIP
LDSKSQAFYLITRIQDEVHRFAITFHRNLHNKNSLASKLDEIKGIGPKSRNKLLKNFGSL
KKIREASIEDLKGVGLTLTQAQSVKLVLENSQN

KEGG   T30595 (Metagenome): 5603
Entry
5603              CDS       T30595                                 

Gene name
uvrC
Definition
excinuclease ABC, C subunit
  KO
K03703  excinuclease ABC subunit C
Best hit
ppe:PEPE_1135 (best score: 684.871)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.5603-T1-C
LinkDB
Position
C127185:complement(2..1567)
AA seq 522 aa
IENKLKLLPEQPGCYLMKNINGTVIYVGKSKNLKNRVRSYFKSKQVGRRAELVKEIADFD
IITVTSDKESFLLEITLIKKYQPYYNVQLKQGTGYPYIEITNEKDPQTRLTSIVHKDNGY
YFGPYPNVYAAQATLRFIQKVWPLRRCSGHQGRPCLYYHMGQCLGACFQEVPRSKYEAQI
AKIKRFLNGDIGQVKQELTEKMQLASSNLEFERAAEIRDQLRYIEQTVEKQKIISNDHTQ
RDIFNFYVDKSWISVQIFFLRQAKLLRRETKMFPLMDLSEPKDEFMSFIVQFYNQKNRIL
PKEILVPKGLDNDNLSEVLGVKVRTPQRGTKRDLLKMAKDNAKLKLDEKFRLLELGNRKT
KGAQAEIFKALGLPYGSIIESFDHSHIQGTDPVSACVVFKDGEPFKTAYRKYKLKGEVEH
QNGADEVGNTREVVRRRYSRMLKEHTRLPDLILMDGGQIQVDACLDVLRNELNCDIPVAG
MVKDNHHHTNHLIFGDPINGKPLELIPMNPKSEGFYLMTRIQ

DBGET integrated database retrieval system