KEGG   T30595 (Metagenome): 4938
Entry
4938              CDS       T30595                                 

Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
lmo:lmo1032 (best score: 151.754)
Taxonomy
Firmicutes - Bacilli [GN:lmo]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS047335.4938-T1-C
LinkDB
Position
C125720:1..369
AA seq 122 aa
EAAMAAGNYSLDNLTAIVDHNDLQISGTTDSVMRSNPISDKYRAFGWDVQEVDGNNMEAL
VNILNKANNTNKPRLIIANTVKGKGITVAENRADWHHKIPSPEEYEQGIKQLNAQMEALE
NE

KEGG   T30595 (Metagenome): 4316
Entry
4316              CDS       T30595                                 

Definition
transketolase, beta subunit
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
ttm:Tthe_1907 (best score: 115.161)
Taxonomy
Firmicutes - Clostridia [GN:ttm]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS047335.4316-T1-C
LinkDB
Position
C122830:2..394
AA seq 131 aa
AIPDLEIYQPCDKYQVRALFKYLVKSDKPAYVRIGKRKLDNVYHEDFEFKPGKAKVIRSG
KDICLISTGETLYFALQAANNLAKQGIDAEVVDLGSIKPLDTEMLGKLAQEFDQIATVEE
HDVINGIGSAV

KEGG   T30595 (Metagenome): 5369
Entry
5369              CDS       T30595                                 

Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
lmo:lmo1032 (best score: 109.383)
Taxonomy
Firmicutes - Bacilli [GN:lmo]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS047335.5369-T1-C
LinkDB
Position
C126774:complement(2..406)
AA seq 135 aa
MTVSYVNLKPKQDLFEVNNMEILDLKKKAVQLRKRTWELIYKHHNGHTGSDLSCTDILVA
LYYDVMNQNAKNFGQKDVDTYIQSKGHAVEIWYEILADLGYINQKDLDERYSTFNSPYIG
HPTTEVHGMAFHTGS

KEGG   T30595 (Metagenome): 4939
Entry
4939              CDS       T30595                                 

Definition
transketolase, beta subunit
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
lmo:lmo1033 (best score: 163.696)
Taxonomy
Firmicutes - Bacilli [GN:lmo]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS047335.4939-T1-C
LinkDB
Position
C125720:362..775
AA seq 138 aa
MNKIDEKLTANQAIANCLDEETKNDPNLLVVTCDSRGSAGLVPFTNKYPDRTVEMGIAEQ
NAVTVAAGLAHEGKHPFVFSPAAFLAMRSIEQVKVDVAFNKNNVKLIGISGGNSYTWLGT
THHSLNDVAITRAIPDLE

DBGET integrated database retrieval system