KEGG   T30595 (Metagenome): 5088
Entry
5088              CDS       T30595                                 

Gene name
thiI
Definition
probable tRNA sulfurtransferase
  KO
K03151  tRNA uracil 4-sulfurtransferase [EC:2.8.1.4]
Best hit
lpl:lp_2325 (best score: 333.569)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
04122  Sulfur relay system
Other DBs
HMP: SRS047335.5088-T1-C
LinkDB
Position
C126156:complement(194..907)
AA seq 237 aa
GPGGMPVGTAGKAVMMLSGGIDSPVASYLALKRGVDIEMVHFFSPPYTSDKALAKAKELT
GILANYCGKITFIAVPFAEIQETIKEKLPEGYLMTIQRRFMLRLADMIREKRKGLAIFNG
ESVGQVASQTLESMAAINNVTTTPVIRPVATMDKTEIIRLAEEIGTFDLSVMPFEDCCTI
FAPPRPKTKPRIDKAIEYEKRLDVEGLLQRAMDGIEISTIKPNEKFIDDQTADQDLL

KEGG   T30595 (Metagenome): 2751
Entry
2751              CDS       T30595                                 

Gene name
thiI
Definition
thiamine biosynthesis/tRNA modification protein thiI
  KO
K03151  tRNA uracil 4-sulfurtransferase [EC:2.8.1.4]
Best hit
lpl:lp_2325 (best score: 541.962)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
04122  Sulfur relay system
Other DBs
HMP: SRS047335.2751-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_748:complement(41578..42795)
AA seq 405 aa
MQYTEVMVRYGELSTKGKNRKDFIGRLAGNVTRALQDFPEIEIHPKHDRMHIVLNGAPFD
KIDQRLKLVFGIQTYSPTIKVEKNLDAIKKASLELMQATFKDGMTFKVNTRRSDHEFEYD
TNQLNTMIGDYLFDNMDNLKVKMKKPDLVLRIEVRQDAIYISNQLLHGAGGMPVGTAGRA
VMMLSGGIDSPVASYLAMKRGVEIDMVHFFSPPYTTEKALAKAKELTGILANYSGKINFI
AVPFTEIQEQIKEKLPEGYLMTIQRRFMLQLADRIRAKRGGLAIFNGESVGQVASQTLES
MVAINDVTSTPVLRPVATMDKTEIIKLAEQIGTFDLSIEPFEDCCTIFAPPRPKTKPKLD
EARKLENRLDAEKMIQRAIDGMKITPIYPNQKFLDDKAQEDADLL

KEGG   T30595 (Metagenome): 4555
Entry
4555              CDS       T30595                                 

Gene name
thiI
Definition
probable tRNA sulfurtransferase
  KO
K03151  tRNA uracil 4-sulfurtransferase [EC:2.8.1.4]
Best hit
ppe:PEPE_1293 (best score: 265.774)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
04122  Sulfur relay system
Other DBs
HMP: SRS047335.4555-T1-C
LinkDB
Position
C123954:2..484
AA seq 161 aa
LPVGTAGKGMMMLSGGIDSPVAAYLGMKRGVSMEMVHFFSPPYTSPQALAKAKQLTEKLA
KYSGSIKFIQVPFAEIQETVKEKVPEGYLMTVQRRMMLRLAAALTMKRHGLAIFNGESLG
QVASQTMESMLVINDVTSLPVLRPVLSYDKTEIIDVAKKID

KEGG   T30595 (Metagenome): 4595
Entry
4595              CDS       T30595                                 

Gene name
thiI
Definition
probable tRNA sulfurtransferase
  KO
K03151  tRNA uracil 4-sulfurtransferase [EC:2.8.1.4]
Best hit
ppe:PEPE_1293 (best score: 193.741)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
04122  Sulfur relay system
Other DBs
HMP: SRS047335.4595-T1-C
LinkDB
Position
C124144:1..501
AA seq 167 aa
MVRYGELSTKGKNRKDFIGRLAGNVEKVLADLENVKIYPKHDRMHIVLNGASFEEVDRRL
KKVFGIQTYSPVIRTEKTLEAIKKTALEIMQAVYKSGMTFKVNTKRADHHFEYDTNQLNL
MVGDYLFDNLQDPKVEMKHPDVVLRLEVRQDAVYISNQLLHGPGGMP

KEGG   T30595 (Metagenome): 2848
Entry
2848              CDS       T30595                                 

Gene name
thiI
Definition
thiamine biosynthesis/tRNA modification protein thiI
  KO
K03151  tRNA uracil 4-sulfurtransferase [EC:2.8.1.4]
Best hit
lpl:lp_2325 (best score: 436.802)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
00730  Thiamine metabolism
01100  Metabolic pathways
04122  Sulfur relay system
Other DBs
HMP: SRS047335.2848-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_766:complement(2419..3441)
AA seq 340 aa
MVRYGELSTKGKNRRDFIAKLADNIQKALSTFPAIKIYPKHDRLHIILNGAPFDEIDQKL
KKVFGIQTYSPVIKTDRTLSAIEETALNLMQATFKDGMTFKINTRRSDHEFEYDTNQLNA
LVGDYLFDHMSDLKVKMKNPDLVLRIEVRKDAIYISNQLLHGAGGMPVGTAGRAVMMLSG
GIDSPVASYLAMKRGVKIDMVHFFSPPYTTDKALAKAEELTGILANYCGKINFIAVPFTE
IQEQIKEKLPEGYLMTVQRRFMLQLADKIREMRGGLAIFNGESVGQVASQTLESMVAIND
VTNTPVLRPVATMDKTEIIALADKIGTFELSIQXXXXXXX

DBGET integrated database retrieval system