KEGG   T30595 (Metagenome): 5120
Entry
5120              CDS       T30595                                 

Gene name
uvrB
Definition
uvrABC system protein B
  KO
K03702  excinuclease ABC subunit B
Best hit
thl:TEH_13040 (best score: 172.17)
Taxonomy
Firmicutes - Bacilli [GN:thl]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.5120-T1-C
LinkDB
Position
C126242:3..485
AA seq 160 aa
VAILDADKEGFLRSTRPLIQTMGRAARNSDGTVIMYADKITDSMRIAIDETRRRREKQIA
FNKEHGIVPKTIVKPIRDVISITKPVKEEKEKESFAELNFDELTKKQKQTMIKNLTEQMQ
EAAKKLDFEAAANLRDAIMELQNSVHTPKKHKGKDFNGKR

KEGG   T30595 (Metagenome): 1315
Entry
1315              CDS       T30595                                 

Gene name
uvrB
Definition
excinuclease ABC, B subunit
  KO
K03702  excinuclease ABC subunit B
Best hit
ppe:PEPE_0448 (best score: 960.674)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.1315-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_325:6921..8936
AA seq 671 aa
MIRRQKNKKFELVSKFQPAGDQEQAIKKLTDGFEQGEKAQILEGATGTGKTFTMANVIAK
LNKPTLVISHNKTLVGQLYGEFKEFFPKNAVDYFVSYYDYYQPEAYVPQSDTYIEKDSSI
NDEIDQLRHKTTSDLMSRNDVIVVASVSCIYGLGDPREYAASVVSISEGQEISRDVLLRD
LVNIQYDRNDIDFQRSRFRVRGDVVEIFPAGYSDHAFRVEFFGDEIDRIVEVDSLTGEVI
GEREQVSIFPATHFVTNEQIMQRALASIKDEMNIQVKKFEGEGKLLEAQRIKQRTTYDME
MMSEVGYTNGIENYSRHMEGRKAGQPPHTLLDFFPDDFLILIDESHATMPELKAMYNGDR
ARKQTLIDYGFRLPSALDNRPLKLEEFEKHVNQIMYVSATPGDYELNQTDHKVEQIIRPT
GLLDPEIEVRPIKGQIDDLVGEINKRIDRNERVFVTTLTKKMAEDLTDYLKDLGIKVRYL
HSDIKTLERLEIIRDLRLGKFDVLIGINLLREGIDVPEVSLVAILDADKEGFLRSTRPLV
QTIGRAARNSNGKVIMYADSITDSMREAIDATERRRSLQMKFNKEHGITPKTIVKPIRDV
ISITKDSDEKENKESFADLNFDELTKKQKQTMIKTLTAQMQEAAKKLDFEEAANLRDAIM
DLQKQVHEKKK

KEGG   T30595 (Metagenome): 1632
Entry
1632              CDS       T30595                                 

Gene name
uvrB
Definition
uvrABC system protein B
  KO
K03702  excinuclease ABC subunit B
Best hit
ppe:PEPE_0448 (best score: 130.568)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.1632-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_435:172..510
AA seq 112 aa
LSVGEEYERDLLLRDLVNIQYDRNDLDLQRGHFRVHGDIVEIFPAGNSNKVYRVEYFGDE
IDQIVEANSLTGEILGKCEQISLFPATHFMTDSEQMKRAIXXXXXXXLYQWH

KEGG   T30595 (Metagenome): 1633
Entry
1633              CDS       T30595                                 

Gene name
uvrB
Definition
uvrABC system protein B
  KO
K03702  excinuclease ABC subunit B
Best hit
ppe:PEPE_0448 (best score: 117.472)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.1633-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_435:527..745
AA seq 73 aa
MDNRKAGEPPYTLLDFFPDDFLILIDESHATMPELQAMYNGDRRRKQTLIDYGFRLPSAL
DNRPLKLLEFEKH

KEGG   T30595 (Metagenome): 6411
Entry
6411              CDS       T30595                                 

Gene name
uvrB
Definition
excinuclease ABC, B subunit
  KO
K03702  excinuclease ABC subunit B
Best hit
ppe:PEPE_0448 (best score: 819.305)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.6411-T1-C
LinkDB
Position
C128347:3869..5443
AA seq 525 aa
MIKRQTNRKFDLVSKYKPAGDQGQAIDKLTAGFKAGAKEQILQGATGTGKTFTMANIIAK
LNKPTLVISHNKTLVGQLYGEFKEFFPNNAVEYFVSYYDYYQPEAYVPSSDTYIEKDSSI
NDEIDQLRHRATSALMERNDVVVVASVSCIYGLGDPREYAASVLSLHEGQEYDRNVLLRD
LVNIQYDRNDIDFQRGRFRVRGDIVEIFPAGNSNHAYRVEFFGDEIDRIVEVDSLTGEVI
GERDQVSLFPATHFMTNEEQMKQALKRISQEMDLQVKKFEGEGKLLEAQRIKQRTTYDME
MMSEVGYTNGIENYSAPIEGRKAGEPPHTLLDFFPDDFLILIDESHATMPEIRAMYNGDR
KRKETLIDYGFRLPSALDNRPLKLEEFEKHVNQILYVSATPGDYELNRTGKIVEQIIRPT
GLLDPKIEVRPIQGQIDDLVGEINKRIDRDERVFVTTLTKKMAEDLTDYLKDLGIKVRYL
HSDIKTLERMQILHDLRKGDFDVLIGINLLREGIDVPEVSLVAIL

KEGG   T30595 (Metagenome): 2153
Entry
2153              CDS       T30595                                 

Definition
helicase C-terminal domain protein
  KO
K03702  excinuclease ABC subunit B
Best hit
wko:WKK_06150 (best score: 270.781)
Taxonomy
Firmicutes - Bacilli [GN:wko]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.2153-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_574:complement(2094..2711)
AA seq 205 aa
KMSEDLTDYLKELGIKVQYLHSEIKTLERMKIIRDLRLGKFDVLVGINLLREGIDVPEVS
LVAILDADKEGFLRSTRPLVQMMGRAARNENGKVIMYADHITDSMQAAIDVTERRRNIQM
LFNQKHHIIPKTIVKPIRDIISHTKDVDQKDKHINDFSDLNFDELSAKQKEQMIINLTEQ
MKIAAQKLDFETAATLRDAIIDLKK

KEGG   T30595 (Metagenome): 1631
Entry
1631              CDS       T30595                                 

Gene name
uvrB
Definition
uvrABC system protein B
  KO
K03702  excinuclease ABC subunit B
Best hit
ppe:PEPE_0448 (best score: 99.7525)
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.1631-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_435:2..181
AA seq 59 aa
FKQFFPNNAVEYFVSYYDYYQPEAYVPSSDTYIEKDSAINDEIDQLRXXXXXXVSFLCR

DBGET integrated database retrieval system