KEGG   T30595 (Metagenome): 5613
Entry
5613              CDS       T30595                                 

Definition
excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Best hit
lpl:lp_2915 (best score: 352.829)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.5613-T1-C
LinkDB
Position
C127203:complement(488..1591)
AA seq 367 aa
VAEGRPEDLENNPKSMIGKYLSGTAKITSLKKQDISLAQSTQLRVKDYFNLHDVEVAIPD
EKLTAVTGFSGAGKTSLILDSLVPAIKNPHALPAQVTKLTTSIKSVISVDAKPVGKNTRS
CVATYTSIMDNLRHLFANLLEAKEQKLKISAFSYNNKQGACPTCQGLGKISLDLQYLPDM
EQVCPTCQGQRFAPDILKIKWHNYSIAELLNLSVNEAIPVFSHESKILRELTLLQEVGLG
YLHLGESTPELSGGEAQRLKLIKHLQKSCKHTLFVFDEPTIGLHPSDIQVLLKVLRRLQK
KGATIVIITHDLDIMTNCDYLIDLGPKGGSNGGQVMATGNPFALVKSNNSSLTLQYLRQH
LLKYHLV

KEGG   T30595 (Metagenome): 531
Entry
531               CDS       T30595                                 

Gene name
uvrA3
Definition
excision endonuclease subunit uvrA
  KO
K03701  excinuclease ABC subunit A
Best hit
lpl:lp_2915 (best score: 522.702)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.531-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_101:9723..11183
AA seq 486 aa
LIKSKEELTLTAKLPTQIEVRGGRVHNLKNIDVNIPLHKFVAISGLSGSGKSSLAMGILY
EEGSRRYLDALSTYMRRRIKQGNQANVTSVKHIPSALALRQRPTIPSERATVGTMSETFN
ILRLIFSRLGSPVCPNGHRLKPSLEIAEAMAKSGEEMGQLTCPVCGVKFYVPSAEQFAFN
SDGACEECGGTGKVRQLDDSKFIADPSLSIKEGAVASWSLPGRNFMPNVAEHAGVRIDIP
YKDLTDKEKDFVLNGPEKKYKMDFLSGTGRVFHDFNALYENAHQAVLRSAKTSKSERAQK
RISEFFSYQTCPVCHGSRLKPGLLKQLVGSLNINEVAEMPLDDLIAWKGQVLKSLPAEMH
KMASALFTEFVENLQPLLDLGLDYLTMARNGNTLSTGELQRIQLARTLRTETTGVLYVLD
EPSIGLHPANVDGLIKVLHKLVAQGNSLVVVDHNVDIIKAADEIIEIGPGSGEQAVKFWI
KVALIK

KEGG   T30595 (Metagenome): 5191
Entry
5191              CDS       T30595                                 

Definition
excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Best hit
lpl:lp_2915 (best score: 372.474)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.5191-T1-C
LinkDB
Position
C126400:complement(3..1013)
AA seq 337 aa
SLAIAKAMDAPGDKMGEITCPTCQVEFMAKSAEDFAYNSGGACPKCHGTGKVQTLDPTKI
IPDDNKTINEGAVASWRLPGRNFMNTIAATLGVRLDVPFKDLTNKEKDIVLHGEKKKYAV
DFHTSTGRVYSTDGTLYENAYEAVYASLKTAKTERSLTRINKFFKFSTCPLCHGNRLNPE
LLKQTVAGMNIAEVSNLTLAELVHFECKTINWLPEEMKGIAKAIFKDLEDNLTPLLDLGL
DYLTLARNGNTLSTGELQRIQLARTLRTETTGVLYVLDEPTIGLHPDNVSGLLKIFRKLI
DQGNSLVVVDHEVSVIEAADWVIEIGPEAGEMGGRIV

KEGG   T30595 (Metagenome): 1316
Entry
1316              CDS       T30595                                 

Gene name
uvrA
Definition
excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Best hit
lpl:lp_0773 (best score: 1431.39)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.1316-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_325:8951..11812
AA seq 953 aa
MVNDKIVIHGAREHNLKDINLSIPKDKLVVITGLSGSGKSSLAFDTLYAEGRRRYVESLS
SYARQFLGQMDKADVDSIDGLNPAISIDQKTTSHNPRSTVGTVTEINDYLRLLWARVGHP
ICPNDGTLIERQSVDQMVDRVMDLPERSRIQILAPVIRAKRGEHKEVFKRIQRAGYVRVI
VDGEMHEITDDFDLDKNKRHSIDIVVDRLIVKENIRSRLFDSVEAALRLADGYMDVDVIK
GKRINFSEYYACPVCGFTVGEMEPRLFSFNAPFGACPDCDGLGMKLSVDEDLVIPDKDKT
LAEGALAPWSNSKYYTAMLEQACKALKIPIDKPYKKLTKRQKDLILNGSKGKKIKFHLEG
DFGVNDTVQEFEGILNNISRRYHHPMSKFMRDVMGKYMTELTCSTCHGKRLNEKALAVKV
NGKDIAEASDLSISKSLKFFNSVKLSEQEKMIAKPILKEVRDRLTFLKNVGLDYLTLSRS
AGTLSGGEAQRIRLATQIGSNLSGVMYILDEPSIGLHQRDNDRLISSLKKMRDLGNSLIV
VEHDDETMKQADYLVDMGPGAGAYGGKVMAAGTPEEVMKNPKSLTGQYLSGKKIVPVPLE
RRKGNGKKITVTGAAENNLKDISVDFPLGKFIVVTGVSGSGKSTLVNLILKRALAQKLNN
NSAKPGKYKSIKGYKNIEKIIDIDQSPIGRTPRSNPATYTSVFDDIRALFAQTNEAKMRG
YTKARFSFNVKGGRCEACHGDGIIKIEMNFLPDVYVPCEVCHGTRYNSETLEVTYREKNI
SQVLNMTINEACKFFENIPKIHRKLQTIVDVGLGYVKLGQSATTLSGGEAQRMKLASELQ
KLSTGNNFYILDEPTTGLHTDDIKRLLEVLQRLVDEGNTVLIIEHNLDVIKNADWLIDLG
PEGGDGGGQVVATGTPEEVAEVKESYTGQYLKPVLERDTKLTKKLMNSKGDQE

KEGG   T30595 (Metagenome): 532
Entry
532               CDS       T30595                                 

Definition
excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Best hit
lpl:lp_2915 (best score: 357.066)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.532-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_101:11237..12262
AA seq 341 aa
MARKRAEKVNSVKISFNVDHYFNLQDVHANIPVNQLTAVTGFSGAGKTSLILDSLVPAIQ
AQAKGENLPKQVKNFESPINQVVSVDASPIGKASTLTVATYTSIMDNLRKLFARQPLAKN
KHYTPTYFSYNNKQGACPTCGGTGIVTLDIQFLPDMQQICPTCEGNRYNPEVQKVKWNGY
SIVDILNLDINEAIPVFKKEPKIERDLLLLKEVGLDYLHLGESTPTLSGGEAQRLKLVTH
LSHKQDDTLFVFDEPTIGLHPLDVKVLVQVMQKLLDQGATIITITHDLNMIVNADNILDL
GPRGGKNGGKVVAAGQTQDLINHPVSLTTEYLANYWRQFKK

KEGG   T30595 (Metagenome): 5356
Entry
5356              CDS       T30595                                 

Gene name
uvrA
Definition
excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Best hit
lpl:lp_0773 (best score: 527.324)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.5356-T1-C
LinkDB
Position
C126744:complement(3..1196)
AA seq 398 aa
PVIRQKRGMYQEVFKKVARAGFVRLIVDGEMHEVSDEFNLDKNKKHSISIVVDRLIVKDG
IKSRLTDSVESALRLSEGYMDVDVIGNQVLNFSEDYACPKCGFTVGEMEPRLFSFNAPFG
ACEACDGLGMKLAVDEDLVVPDKDKTLNEGAIAPWANSDYYKMMLTQACQSLRINMDKPF
KKLTERQKNLVLYGSDKKIKFHLEGDFGVNDTTQAFEGVMNNIDRRYHHPMSQFMREVMG
KYMTELTCAVCHGKRLNQKALAVKVMGQDISEVSDLPIGKELTFFKSVKLTEAENMIAKP
ILKEVIDRLTFLVNVGLDYLTLSRSAGTLSGGEAQRIRLATQIGSNLSGVMYILDEPSIG
LHQRDNDRLIASLKKMRDLGNSLIVVEHDDETMKQADY

KEGG   T30595 (Metagenome): 2152
Entry
2152              CDS       T30595                                 

Gene name
uvrA
Definition
excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Best hit
efa:EF0763 (best score: 696.427)
Taxonomy
Firmicutes - Bacilli [GN:efa]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.2152-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_574:complement(435..2066)
AA seq 543 aa
MKNDVIVMHGVREHNLKNIDLTIPKNKLVVVTGLSGSGKSSLAFDTLYTEGRRRYVESLS
SYARQFLGQMDKADVDSIEGLTPAISIDQKTRSHNPRSTVGTVTEINDYLRLLWARVGKP
ICPHDGTLIESQSVDQIIKQILALAPKTRIQILAPIIRQKKGEHKEVFKRIQRLGYVRII
VDGVLHDINDELLLDKNKQHSISVVVDRLIIKEQIKSRLTDSVETALRLTDGYLNVDIVG
DKLMKFSEYYACPSCGFTVGELEPRLFSFNAPFGACSECDGLGMKLAVDPDLVIPDPEKS
LNQGAIVPWCNSKYYTDMLLQVAATFKIPMDRPFKKLTERQKRIILYGDDKVIKFHLTGD
FGVNDVEQAFEGVLNNVDRRYHHPISKFMQDVMSKYMTELKCTKCQGRRLNEIALSVKIN
GYDLAAVSDLAIMDELAFFESIALSEHDMMIAKPILKEVKARLTFLIDVGLGYLTLSRSA
GTLSGGESQRIRLATQIGSNLSGVMYILDEPSIGLHQRDNARLIKTXXXXXXLDLVQVYM
VEK

KEGG   T30595 (Metagenome): 2151
Entry
2151              CDS       T30595                                 

Definition
putative excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Best hit
wko:WKK_04510 (best score: 172.555)
Taxonomy
Firmicutes - Bacilli [GN:wko]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.2151-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_574:complement(1..408)
AA seq 136 aa
MANPDSLTGQYLSGKKKIAIPDHRRTLNHGVIKLIDVSENNLKHIDVQIPLGGLVLVTGV
SGSGKSTLVNLVLKRAILQKLGLMTKKPGKYKKMLGWDQIKKVIDVDQSPIGRTPRSNPA
TYTGVFDDIRALFAQT

KEGG   T30595 (Metagenome): 6107
Entry
6107              CDS       T30595                                 

Definition
excinuclease ABC, ATP binding subunit
  KO
K03701  excinuclease ABC subunit A
Best hit
lpl:lp_2915 (best score: 182.57)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.6107-T1-C
LinkDB
Position
C127965:2678..3091
AA seq 138 aa
MIEKSNFPPKNIEVRGASINNLKNIDIDIPLHKFVAITGPSGAGKSSLAMGILYAEGSRR
YLEALSTYTRRRISQAKETGVREVRHIPSAIALRQRLTVPSERSTVGSMSEILSVIRLIF
SRLASPVCPNGHKIAPSL

KEGG   T30595 (Metagenome): 3934
Entry
3934              CDS       T30595                                 

Definition
excision endonuclease subunit uvrA
  KO
K03701  excinuclease ABC subunit A
Best hit
lsi:HN6_00976 (best score: 176.792)
Taxonomy
Firmicutes - Bacilli [GN:lsi]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.3934-T1-C
LinkDB
Position
C121364:3..323
AA seq 107 aa
DVDSIDGLSPAISIDQKTTSHNPRSTVGTVTEINDFLRLLWARVGTPICPNDHIPISSQS
PDQMVDRVLELPERTRLQILSPVVRDKRGTQKKIFEKIKKEGFVRVQ

KEGG   T30595 (Metagenome): 1017
Entry
1017              CDS       T30595                                 

Gene name
uvrA
Definition
excision endonuclease subunit uvrA
  KO
K03701  excinuclease ABC subunit A
Best hit
vir:X953_14010 (best score: 236.884)
Taxonomy
Firmicutes - Bacilli [GN:vir]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.1017-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_180:2..454
AA seq 151 aa
TLEVKYHEKNIADVLKMTISEANEFFANIPKIQRKLQTIMDVGLGYIQLGQPATTLSGGE
AQRMKLASELQKTSTGKNLYILDEPTTGLHVDDIKHLVLVLQRLVDEGNSVLIIEHNLDV
IKCADWIIDLGPEGGAAGGEIVAQGTPEDVA

KEGG   T30595 (Metagenome): 5822
Entry
5822              CDS       T30595                                 

Definition
excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Best hit
vte:BHY08_03900 (best score: 595.89)
Taxonomy
Firmicutes - Bacilli [GN:vte]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.5822-T1-C
LinkDB
Position
C127573:1..1203
AA seq 400 aa
MKQADYLIDMGPGAGSFGGKVMAAGTPEEVMANPNSLTGQYLSGKKFIPVPTERRKGNGK
KITVSGACEHNLKDITVDFPLGKFVVVTGVSGSGKSTLVNTILKRALAQKLNHNSAKPGK
FAKITGYKEIEKIIDIDQSPIGRTPRSNPATYTSVFDDIRALFAQTNEAKIRGYTKARFS
FNVKGGRCEACHGDGIIKIEMNFLPDVYVPCEVCHGRRYNSETLEVTYHDKNIAQVLDMT
ISEACEFFEKIPKIHRKLQTIVDVGLGYVKLGQSATTLSGGEAQRMKLASELQKLSTGNN
FYILDEPTTGLHVDDIKRLLVVLQRLVDQGNTVLVIEHNLDVIKTADWLIDLGPEGGEGG
GQVVVTGTPEHVVECDKSWTGKYLKPVLKRDTERTLQAKK

KEGG   T30595 (Metagenome): 5121
Entry
5121              CDS       T30595                                 

Gene name
uvrA
Definition
excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Best hit
ppe:PEPE_0449 (best score: 268.085)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
03420  Nucleotide excision repair
Other DBs
HMP: SRS047335.5121-T1-C
LinkDB
Position
C126242:472..939
AA seq 156 aa
MVRDKIEIHGAREHNLKDIDLTIPKDKLVVVTGLSGSGKSSLAFDTLYAEGRRRYVESLS
SYARQFLGQMDKADVDSIDGLNPAISIDQKTTSHNPRSTVGTVTEINDYLRLLWARVGHP
ICPNDGTLIERQSVDQMVKRVLELPERSKIQILAPV

DBGET integrated database retrieval system