KEGG   T30595 (Metagenome): 5657
Entry
5657              CDS       T30595                                 

Definition
chaperone protein clpB
  KO
K03695  ATP-dependent Clp protease ATP-binding subunit ClpB
Best hit
faa:HMPREF0389_00724 (best score: 110.923)
Taxonomy
Firmicutes - Clostridia [GN:faa]
Pathway
04213  Longevity regulating pathway - multiple species
Other DBs
HMP: SRS047335.5657-T1-C
LinkDB
Position
C127297:complement(2..403)
AA seq 134 aa
MTYFDNDFDNLFNELNKSFFNDDNGNTRYYFSSNSANPQTVQQIEKPKQKENKIGRDLVK
EAKDKKFDPVIGRDDQINAVIEILSRRKKNNPVLIGPAGVGKTSIVEGLAQRIASGDVPD
KLRKMHIYELNIND

DBGET integrated database retrieval system