KEGG   T30595 (Metagenome): 5910
Entry
5910              CDS       T30595                                 

Gene name
ddl
Definition
D-ala D-ala ligase N-terminal domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Best hit
axl:AXY_03120 (best score: 178.718)
Taxonomy
Firmicutes - Bacilli [GN:axl]
Pathway
00473  D-Alanine metabolism
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01502  Vancomycin resistance
Other DBs
HMP: SRS047335.5910-T1-C
LinkDB
Position
C127685:1752..2396
AA seq 215 aa
MTDKTRVGLIFGGNSSEYEVSIVSGHNIYNAIDKEKYDVYPIWLTKDNYFASLEDSKKVW
DDPTYTIKNPHKLANVSNFEQLANLPEMDVYFPIVHGNIGEDGVIQGFFRMLDKPFVGDD
VLAAAVTMDKEFTKILAQRAGVPVADWVAIKRFEYNDKNNSKLDYKYVSEKLGTDLFVKP
SNQGSSVGITHVKSESDYLPALAEAFKYDDKVLVE

KEGG   T30595 (Metagenome): 1424
Entry
1424              CDS       T30595                                 

Gene name
ddl
Definition
D-ala D-ala ligase N-terminal domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Best hit
vir:X953_02445 (best score: 296.204)
Taxonomy
Firmicutes - Bacilli [GN:vir]
Pathway
00473  D-Alanine metabolism
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01502  Vancomycin resistance
Other DBs
HMP: SRS047335.1424-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_364:5252..6337
AA seq 361 aa
MTDKIKVGLIFGGNSSEYEVSIMSAHNIYEEIDTNKFDVYPMWITNDGYLANDADSRKVL
DNPKMEVANPHKVANISNIVELKDRPEIDVFFPIVHGNLGEDGCLQGLFRVLDKPFVGDD
VLAAAVTMDKEMTKILAQRAGVPVAKWIAVKRFEYNDPDNNKLDYEYVASQLGSDLFVKP
SNQGSSVGVSHVTNEKEYKVALAEAFKYDDKVLVEETVHGTEVETAVLGNDKPIVAGVGQ
IINAKDSFYTYENKYDDNSTSTLEIPAKLPEGIVEKVRKNALKVFQATECSGLARIDSML
RTEDKEVVLTEVNALPGFTNISMYPKLFEEVGIPYTDLITKLIDYAMERYDHKKTLLHKH
D

KEGG   T30595 (Metagenome): 5353
Entry
5353              CDS       T30595                                 

Gene name
ddl
Definition
D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Best hit
ebt:EBL_c29420 (best score: 159.458)
Taxonomy
Gammaproteobacteria - Enterobacteria [GN:ebt]
Pathway
00473  D-Alanine metabolism
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01502  Vancomycin resistance
Other DBs
HMP: SRS047335.5353-T1-C
LinkDB
Position
C126738:complement(734..1195)
AA seq 153 aa
DDKVLVEEAITGTEVETAVLGNDDIIVSGVGQIINAKGSFYSYKNKYDDSSTTTLQIPAD
LPAEIVEKVRSNAEKIYRATECSGMARIDSMLRTSDHEVIFNELNALPGFTNISMYPKLF
EEAGIKYTDLISRLIELAVERHNHKKTLLHKPE

KEGG   T30595 (Metagenome): 1870
Entry
1870              CDS       T30595                                 

Definition
D-ala D-ala ligase N-terminal domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Best hit
ebt:EBL_c29420 (best score: 155.221)
Taxonomy
Gammaproteobacteria - Enterobacteria [GN:ebt]
Pathway
00473  D-Alanine metabolism
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
01502  Vancomycin resistance
Other DBs
HMP: SRS047335.1870-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_498:139..750
AA seq 203 aa
MLLNYLXXXXXDVLAAAITMDKELNKIMAQRAGVPVADWISIKRFEYNDAKNEKLSYDYV
SQKLGTDLFVKPSNQGSSVGISHVTSAADYEKALAEAFKYDDKVLVEXXXALPSEIIETV
RRQALKVYHATECSGLARVDSMLSSDNKVIFNELNSLPGFTNISMYPKLFEQVGISYTEL
ITKLLNYALDRYAHKKTLLHKHD

DBGET integrated database retrieval system