KEGG   T30595 (Metagenome): 5977
Entry
5977              CDS       T30595                                 

Gene name
adk
Definition
adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Best hit
ljo:LJ_0357 (best score: 378.637)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00230  Purine metabolism
00730  Thiamine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01240  Biosynthesis of cofactors
Other DBs
HMP: SRS047335.5977-T1-C
LinkDB
Position
C127773:complement(329..982)
AA seq 217 aa
MINLILLGLPGAGKGTVSERIVDKYKLAHISTGDMFREAMANETPVGLEAKSYIDKGNLV
PDEVTAKLVEERLAKPDTNNGFILDGFPRTTAQAEMLEDITKRLNKPLTNVIALDVEESV
LVDRLSARFMCKACGATYNKFSKKPKVEGTCDRCGGHEFYQREDDKPEVVRNRLQVNEKM
NAPLRDFYQQKGLLSVVNGEQSPEKVFEDTDAILGKD

KEGG   T30595 (Metagenome): 456
Entry
456               CDS       T30595                                 

Gene name
adk
Definition
adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Best hit
ljo:LJ_0357 (best score: 428.328)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00230  Purine metabolism
00730  Thiamine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01240  Biosynthesis of cofactors
Other DBs
HMP: SRS047335.456-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_87:5757..6410
AA seq 217 aa
MINLILLGLPGAGKGTASESIVDKYHLAHISTGDMFREAMANKTPVGLEAKSYIDKGDLV
PDEVTAKLVEERLKQPDTKNGFILDGFPRTTVQAELLEGITKRLEKPLTNVIAIDVDEDV
LIKRLSARYICKNCGATYNKISNPTKVEGTCDRCGGHEFFQREDDKPEVVKNRLEVNKKM
NTPLRDFYEEKGILSTVNGEQTPEKVFEDIDKILSKD

KEGG   T30595 (Metagenome): 293
Entry
293               CDS       T30595                                 

Gene name
adk
Definition
adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Best hit
ljo:LJ_0357 (best score: 56.225)
Pathway
00230  Purine metabolism
00730  Thiamine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01240  Biosynthesis of cofactors
Other DBs
HMP: SRS047335.293-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_69:complement(3..89)
AA seq 29 aa
MINLILLGLPGAGKGTASERIVDEFHLAH

KEGG   T30595 (Metagenome): 1963
Entry
1963              CDS       T30595                                 

Gene name
adk
Definition
adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Best hit
ljo:LJ_0357 (best score: 152.91)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00230  Purine metabolism
00730  Thiamine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01240  Biosynthesis of cofactors
Other DBs
HMP: SRS047335.1963-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_532:1..252
AA seq 83 aa
CGATYNKISNPTKVEGKCDRCGGSEFYQRDDDKPEVVKNRLEVNKKMNTPLKDFYDKKGI
LSSVNGEQTPDKVFEEIYDILKK

DBGET integrated database retrieval system