KEGG   T30595 (Metagenome): 5978
Entry
5978              CDS       T30595                                 

Gene name
secY
Definition
preprotein translocase, secY subunit
  KO
K03076  preprotein translocase subunit SecY
Best hit
lpl:lp_1056 (best score: 584.719)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.5978-T1-C
LinkDB
Position
C127773:complement(996..2288)
AA seq 430 aa
MFSTLKNAFKDKEIRNKIFFTLFILLLYRIGANIAVPGVNAKAINQVAQTGLVPMLDTVS
GGGLDNYSIFSLGVSPYITAQIVIQLLQMDIVPKLVEWGKQGEVGRRKTNQVTRYLTLVV
AFIQSIGITLGFNVLTQMGLVKSQTPQTYIQIAIIMTAGTFLLTWLGDEITDKGLGNGVS
VIIFAGIISRLPNGIAQIFKEDVSNASSSDRWKGILFFVAIIIAILVITKVVTWVEQAIR
RVPIQYTRRAAVSGSESFLPLKVNVSGVIPVIFASSFIITPSTILMAFQSHQGEQWYQIL
TQIFSLQTTPGAVIYTLLIVLFTFFYAFVQVNPEKLSENLQKQSAYIPSVWPGKDTQDFV
SKLLMRLSTVGSVYLGLVALLPQLATNIWGLPSSIGLGGTSLLIVIGVVLELSRQVNGLL
MKREYVGFIR

KEGG   T30595 (Metagenome): 294
Entry
294               CDS       T30595                                 

Gene name
secY
Definition
preprotein translocase, SecY subunit
  KO
K03076  preprotein translocase subunit SecY
Best hit
efa:EF0227 (best score: 102.064)
Taxonomy
Firmicutes - Bacilli [GN:efa]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.294-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_69:complement(99..299)
AA seq 66 aa
MRISTVGAIFLGLVALLPQLATNMWNLPQSIGLGGTSLLIVIGVVLELSRQIDGLLMKRE
YVGFIR

KEGG   T30595 (Metagenome): 455
Entry
455               CDS       T30595                                 

Gene name
secY
Definition
preprotein translocase, secY subunit
  KO
K03076  preprotein translocase subunit SecY
Best hit
ppe:PEPE_1398 (best score: 567.385)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.455-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_87:4450..5745
AA seq 431 aa
MFSTLKNAFKDKDIRSKIFFTLFILLLYRIGANITVPGVNAKAITRVAQTGLVPMLDTVS
GGGLDTYSIFSLGVSPYITAQIVIQLLQMDIVPKLVEWGKQGEVGRRKTNQVTRYLTLVV
AFVQSLGITLGFNVLTEMGLVKTQTPQTYIEIAIIMTAGTMLLTWLGDEITDKGLGNGVS
VIIFAGIIARLPNGIYQLFKDFIINNSASDRWQGILFFIAIIIAILLVTQFVTWFQQADL
RVPIQYTRRAATSGSESFLPLKVNVSGVIPVIFASSFIITPATILMVFQRSHGNEQWFKI
CNQIFSLQTTPGALIYTLLIILFTFFYAFVQVNPEKLAENLQKQGAYIPSVWPGKDTQKY
VSKILIRLSTVGAVFLGLVALLPQLATNIFGLPSSIGLGGTSLLIVIGVVLELARQVDGL
LMKREYVGFIR

KEGG   T30595 (Metagenome): 296
Entry
296               CDS       T30595                                 

Gene name
secY
Definition
preprotein translocase, SecY subunit
  KO
K03076  preprotein translocase subunit SecY
Best hit
efa:EF0227 (best score: 63.5438)
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.296-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_69:complement(946..1197)
AA seq 83 aa
MFTTLKNAFKDKEIRGKIYYTLFILLLYRIGANIAVPGINAKALAILANSSAKNLIPMLD
TISGGGXXXXXXXXXXXIRLLDI

KEGG   T30595 (Metagenome): 295
Entry
295               CDS       T30595                                 

Gene name
secY
Definition
preprotein translocase, SecY subunit
  KO
K03076  preprotein translocase subunit SecY
Best hit
lpl:lp_1056 (best score: 171.785)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.295-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_69:complement(266..883)
AA seq 205 aa
MGLVRTQTVETYVQIAIIMTAGTMLLTWLGDEITDKGLGNGVSVLIFAGIIARLPHGLYK
LFNDSIINTSSSDRINGILFFIGMLIIIFLVAKFVTWFQQADLRVPIQYTRRATLSGSES
FLPLKINVSGVIPVIFASSFIVTPATILEAXXXXXXXXLFKLIQRNYLKICKSKVHIYLV
FGQVRILRNMYLKFLCVFQLLVPYF

DBGET integrated database retrieval system