KEGG   T30595 (Metagenome): 6048
Entry
6048              CDS       T30595                                 

Gene name
ftsY
Definition
signal recognition particle-docking protein ftsY
  KO
K03110  fused signal recognition particle receptor
Best hit
spy:SPy_0569 (best score: 363.229)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.6048-T1-C
LinkDB
Position
C127865:1498..2787
AA seq 430 aa
MGLFDKIKKTLFGNNEEKAKQAPSKPEEEKAEVAEETNEVKLEENKVAEVETDAKSAEAE
NESSASEEVKNEPEVSSSKEAQTSLEEVAESKPESEPVDTAASQEVEDSSPEEEKGEEIE
PETESSESKKQELYDNGLKKTNQGFGARLNAFFAQFRSVDENFFDELEDLLIESDVGFET
SEELIDQLKDEAKLQNVKSHDELKKLIVQKLVEIYDQNGDADAEKLTYNEGKTNVYLFVG
VNGAGKTTTIGKLAQRFKQEGKKVVLVAADTFRAGAVEQLKEWGKRTETEVVTGPVQADP
ASVVYDGVKHGLEEDADYVLVDTAGRLQNKQNLMKELEKIERTIKKLVPDQPCETLLVLD
GSTGQNALLQAKDFDKTTKLTGLVLTKLDGSSKGGVILAIRNEMKLPVKLVGLGEKAEDL
ADFDAASYAV

KEGG   T30595 (Metagenome): 1134
Entry
1134              CDS       T30595                                 

Gene name
ftsY
Definition
signal recognition particle-docking protein ftsY
  KO
K03110  fused signal recognition particle receptor
Best hit
vte:BHY08_01300 (best score: 343.969)
Taxonomy
Firmicutes - Bacilli [GN:vte]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.1134-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_242:complement(1213..2250)
AA seq 345 aa
MIKIGEVVMGLFNKLKEKLLGKTEENKDSEITKKDNDIQATYDRGLKKTSNSLGEKLNSF
LAQFRTIDEDFFDDLEDLLIEADVGYETAELLTDELRNEAKLKNVKDSKLLKNVIVEKLV
ELYEQNNTKDSKLILKTGDMPAVFLFVGVNGAGKTTTIGKLAKKLKDAGNSVMLVAADTF
RAGAVEQLKAWGQRVDVQVISGNTNADPSSVVYEGLECAVNNHIDYLLVDTAGRLQNKVN
LMNELDKINRTIHRKIPDQPQEILLVIDGSTGQNALNQAKEFDKTTKLTGLVLTKLDGSS
KGGIVLAIRNEMSLPVKLVGLGEKAEDLAEFDAEKFAIGLFHELI

KEGG   T30595 (Metagenome): 2947
Entry
2947              CDS       T30595                                 

Gene name
ftsY
Definition
signal recognition particle-docking protein ftsY
  KO
K03110  fused signal recognition particle receptor
Best hit
efa:EF3094 (best score: 385.571)
Taxonomy
Firmicutes - Bacilli [GN:efa]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.2947-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_780:52323..53672
AA seq 449 aa
VGLFDKIKKSLFGHKDEDQEEKEEHKVDEEATKETQDSEINTETEVSENESDLASKETNK
TDKEETESSDETPGWSDAGSAFEESQNEVAEKTAEAEDTSSEEEQKSEEYEDKISESETG
TELAANTEEESDEKVAEKEDEQERYDKGLEKTNHSFGARLNAFFAKFRTVDEDFFDDLED
LLIESDVGFETAEELTDSLRDEAKLQNAKSHDDLKQVIVEKLVDIYDKGGEGEDSKLADD
PDAKPNVYLFVGVNGAGKTTTIGKLAKRIKDSGKSVMMVAADTFRAGAVEQLVEWGRRDG
VEVVTGPEKADPASVVYDGVKKAKDRGIDFLLVDTAGRLQNKVNLMSELDKIKRTIKKIL
PDQPNEVLLVLDGSTGQNALLQAKDFDKTTKLTGLVLTKLDGSSKGGVVLAIRNEMDLPV
KLVGLGEKVDDLANFDAEKFAIGLFQGLI

DBGET integrated database retrieval system