KEGG   T30595 (Metagenome): 6322
Entry
6322              CDS       T30595                                 

Definition
aldehyde dehydrogenase (NAD) family protein
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Best hit
wjo:FOL01_1877 (best score: 154.836)
Taxonomy
Firmicutes - Bacilli [GN:wjo]
Pathway
00250  Alanine, aspartate and glutamate metabolism
00310  Lysine degradation
00350  Tyrosine metabolism
00650  Butanoate metabolism
00760  Nicotinate and nicotinamide metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS047335.6322-T1-C
LinkDB
Position
C128255:1..339
AA seq 112 aa
NISKVNPVFDQELFGPVACVYKVKDINEAIELANDSSFGLGSSIISSDINKAQEIASQIE
TGMTVINGRWITAPELPFGGVKNSGYGRELSELGLNAFINEHLVIDCTKINK

KEGG   T30595 (Metagenome): 3468
Entry
3468              CDS       T30595                                 

Definition
NAD-dependent aldehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Best hit
lpl:lp_3092 (best score: 509.605)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
00250  Alanine, aspartate and glutamate metabolism
00310  Lysine degradation
00350  Tyrosine metabolism
00650  Butanoate metabolism
00760  Nicotinate and nicotinamide metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS047335.3468-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_905:4732..6105
AA seq 457 aa
MSKYESINPYTNQLIKSYPDATQEEIEQALDAGEKLYLTWRNQLPATRSQLLHQIANNFK
KHREEIAKTMTLEMGKLYHESLEEVDLCINICNYYAEKAPKMLEPTPLETSLGTAYYLKQ
STGIIMACEPWNFPLYQVIRVFAPNFMVGNPIILKHAHNVPASAQLTEKIIQEAGAPKAS
LQNLFLSYAQIGDVIADKRIQGVAVTGSERGGSSVAEAAGKNIKKSTMELGGNDPFIVLA
DADSTVLKNVLSEARTYNCGQVCTSSKRIIVVESRYDEVMDILHHTFASLKPGNPLDENT
SLAPMNSQKAADKLAAQVKKGIEHGAEVVYQYPEIKSTGAFFRPMILTNIDQNNPLFDEE
LFGPVAEVFKVKDEETAIALANNSSFGLGSSVISENKAHAQEVASEIETGMTVINGRWIT
APELPFGGVKKSGYGRELSELGLMSFVNEHLVIDVSK

KEGG   T30595 (Metagenome): 5071
Entry
5071              CDS       T30595                                 

Definition
aldehyde dehydrogenase (NAD) family protein
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Best hit
lme:LEUM_1090 (best score: 317.39)
Taxonomy
Firmicutes - Bacilli [GN:lme]
Pathway
00250  Alanine, aspartate and glutamate metabolism
00310  Lysine degradation
00350  Tyrosine metabolism
00650  Butanoate metabolism
00760  Nicotinate and nicotinamide metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS047335.5071-T1-C
LinkDB
Position
C126112:complement(3..893)
AA seq 297 aa
ILNKIADNFENNRTQMATIMTKEMGKLYVEALDEVDLCINICRYFAQYGPDMLTSVPLNS
SLGNSYYLKQSIGVIMACEPWNFPLYQIIRVFAPNFIVGNPMILKHAHNVPGCAALAEKI
IKRAGAPEGSMMNLYLSYKQLADVISDKRIKGVALTGSERGGASVAMQAGKYLKKSTMEL
GGNDPFIILNDADDALLKKVLKDARTYNCGQVCTSSKRIIVLEDKYDQVLNELKNIFSNL
KPGNPMDSSTTLAPLNSENAKKKLTNQVNEACEAGATIFYQYPEINEKGAFFRPIIL

DBGET integrated database retrieval system