KEGG   T30595 (Metagenome): 6326
Entry
6326              CDS       T30595                                 

Gene name
lspA
Definition
signal peptidase II
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Best hit
dpm:FNV33_04950 (best score: 131.339)
Taxonomy
Firmicutes - Bacilli [GN:dpm]
Pathway
03060  Protein export
Other DBs
HMP: SRS047335.6326-T1-C
LinkDB
Position
C128257:935..1393
AA seq 152 aa
MQLLYLFIAFLVVLCDQGLKYYISHSYMLGQEHTLIAGLLSFTYVKNSGAAWNILTGQML
IFYIISIIAIIACLYFLYNKKYNNPIFKSGIGLVLGGVIGNFIDRLHLKYVIDMIQLDFI
NFNIFNIADSAITVGIILIFIYLIFFSDKDEK

KEGG   T30595 (Metagenome): 3799
Entry
3799              CDS       T30595                                 

Gene name
lspA
Definition
signal peptidase II
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Best hit
ppe:PEPE_0940 (best score: 98.9821)
Pathway
03060  Protein export
Other DBs
HMP: SRS047335.3799-T1-C
LinkDB
Position
C120862:2..301
AA seq 100 aa
YLRNTGAAWNLLAGKMNLFYLISILALIVVIYYLFSLKYSHQIFKFGLAMVLGGIVGNFI
DRLIFKYVIDMFDLDFINFNIFNLADCAITFGVIFSFYYF

KEGG   T30595 (Metagenome): 1862
Entry
1862              CDS       T30595                                 

Gene name
lspA
Definition
signal peptidase II
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Best hit
dpm:FNV33_04950 (best score: 144.436)
Taxonomy
Firmicutes - Bacilli [GN:dpm]
Pathway
03060  Protein export
Other DBs
HMP: SRS047335.1862-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_497:complement(12404..12868)
AA seq 154 aa
MKRAKQVLYLVISLLVVIADQGLKNYIVTNFKIGDEHTVIPGILSFTYLQNDGAAWNIFS
GQMILFYLISIAAIAVVVYYLFNPKYKNWLFDTGLALVLGGIIGNFIDRLHLKYVIDMLQ
LDFVQFNIFNIADSAITVGIVLVFIYLIFMSEKD

DBGET integrated database retrieval system