KEGG   T30595 (Metagenome): 6505
Entry
6505              CDS       T30595                                 

Definition
hypothetical protein
  KO
K06630  14-3-3 protein epsilon
Best hit
lje:BUE77_01665 (best score: 284.263)
Taxonomy
Firmicutes - Bacilli [GN:lje]
Pathway
04011  MAPK signaling pathway - yeast
04110  Cell cycle
04114  Oocyte meiosis
04151  PI3K-Akt signaling pathway
04390  Hippo signaling pathway
04391  Hippo signaling pathway - fly
04621  NOD-like receptor signaling pathway
04722  Neurotrophin signaling pathway
05160  Hepatitis C
05203  Viral carcinogenesis
Other DBs
HMP: SRS047335.6505-T1-C
LinkDB
Position
C128517:10497..10991
AA seq 164 aa
MNKVSYPEFSELINYYQALTGNELINKQKKQLLKSLRLAKKGDYHHALADLRTEAEKLTK
YWLEQKYIKPDLNFNQNISLLRHSGVSQNVINTLFEIKAAGNKAVHELEANEEVTKKCFY
DYFKVLNTCSRQFVNQESWVIEKAFLIVVVIILGLFLLKLGQPN

DBGET integrated database retrieval system