KEGG   T30595 (Metagenome): 746
Entry
746               CDS       T30595                                 

Gene name
yidC
Definition
membrane protein insertase, yidC/oxa1 family
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Best hit
ppe:PEPE_1845 lpl:lp_3687 (best score: 261.536)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.746-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_122:complement(101777..102652)
AA seq 291 aa
VRNHLSKKNWKLILLGLGMLTLALVVTGCASTNGSSVAPISHTSGNWWDRYIVYYISQFI
LWIASLVRDSYGWAIIIFTIIVRIILLPLNAISIKSMAKQQKVQPQMDALRKKYPGKDVE
SRQKLQEETSKLYKEAGINPYTGCLPMLIQLPVMYALYQAIWRTPQLQNGRFLWMDLGRP
DPYYIMPVLAAAFTFISTYISQMSTPQSSQNGMTKGMTYLMPLIIGVSAIGIQSAISLYW
VISNLFQVVQTFILQNPFKYQRELEEQKKAERERERKVRRVYKRLGRKKQK

KEGG   T30595 (Metagenome): 2188
Entry
2188              CDS       T30595                                 

Gene name
yidC
Definition
membrane protein insertase, yidC/oxa1 family
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Best hit
mps:MPTP_1224 (best score: 207.608)
Taxonomy
Firmicutes - Bacilli [GN:mps]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.2188-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_588:1617..2576
AA seq 319 aa
MKKIKYIITSALIAIIAIITTACATNTGNWTPPLVGPYAWIYNLFGHPLQNIMLHVSNLL
GGTNGAGWAIIIITFVIQLIVLPLRLSSQSKMIKQQEKTKRLQPQLSLIQAAMKKNSNKQ
MQLSQLQMKIYKDNNMSMIGGMGCLPLLIQLPIMIGIYQAVAYSKTLASSSFMGISLSKP
SIVFAVVAAILYLIQGYLSLIGISEQQKQTMLITVIASPLMTLVFSIMYSGALGLYFLVG
GIVIVIQQLIATFILMPKVRADVDKELTKNPIKEVINQEMIDQILNESTDQMSQNKSDEI
TNLHEQLRKRNSGKQNRNK

KEGG   T30595 (Metagenome): 184
Entry
184               CDS       T30595                                 

Gene name
yidC
Definition
membrane protein insertase, yidC/oxa1 family
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Best hit
lpl:lp_1553 (best score: 251.906)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.184-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_40:complement(8852..9835)
AA seq 327 aa
MKSKTKYFSLFAMLTILALILTGCANNSQSIYQAPTSGPYAWVFSLFGKPIQNIMLAVEH
QIGGSNGAGWAIIIITFVVQLIVMPLRLASQRKMTTQQEKTQKLQPQMKLIQEALKKPGL
TQPQQMQISQLQMRVYKDNNMSMMGGMGCLPLLIQLPIMIGIYQAVAYSKELAASSFFGI
SLGQRSIVLTIIATLLYVIQGYLSMVGIPEEQKKAMQMTLILSPAMTFFISISAPGALAL
YFLVGGLIAILQQVITTFIIMPKVKKDVAAELNERPLKVVVTQETIDSILNTTTSSNTGN
EAEKDLHQDLRARNAGKQKRPHNSDKD

KEGG   T30595 (Metagenome): 1745
Entry
1745              CDS       T30595                                 

Definition
membrane protein oxaA
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Best hit
lpl:lp_3687 (best score: 125.561)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.1745-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_486:2..397
AA seq 131 aa
AILRTPELQNGRFLWMDLGHPDPYMVMPILAAIFTFIASYIGQLSQAKSSNNAMTKGMTY
VMPVFIGVMACSLQSALSLYWVISNLFQAIQTFFLQNPIKYYRELKLKQLQEKERKAKYR
KIYKKFGRKIK

KEGG   T30595 (Metagenome): 6034
Entry
6034              CDS       T30595                                 

Gene name
yidC
Definition
membrane protein insertase, yidC/oxa1 family
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Best hit
ppe:PEPE_0716 (best score: 223.016)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.6034-T1-C
LinkDB
Position
C127845:577..1545
AA seq 322 aa
MKKNKKILLLVSLVAMLAIILTGCAAYKTGANAAPKGGFFGLIYQFIGIPIRNIMLATEN
AIGGSNGAGWAIAIITAVIRFVLLPLMLSTSKKSTIQQEKVSRLQDQFKLIQDALKDRSL
TPDKQMQISQLQQKVYRENNLSITGGIGCLPLLVQFPFMIGIYQAVAYSDALYKSNFFGV
SLGKPSLLFAIVGALFYLAQSLLMLRGVSEQQRAAMQSTVFISPLMTLFISMSTPGALGL
YFLVGGIIALIQQVIVTYIILPRAKAKIDAELKEKPMKVVVTKEIIDNIISDNTNTGNST
SSTTAEDELRKRNAGKQKRNDK

KEGG   T30595 (Metagenome): 3710
Entry
3710              CDS       T30595                                 

Gene name
yidC
Definition
membrane protein insertase, yidC/oxa1 family
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Best hit
ppe:PEPE_1845 (best score: 270.011)
Taxonomy
Firmicutes - Bacilli [GN:ppe]
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.3710-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_954:2299..3171
AA seq 290 aa
MKEYRMKDILTKKNVKRFIAFLAVVAIAVVLTGCANSTGHVSHTSGSWWDRYVIFYFSQF
LLWLADLLGKNYGWTIIVFTILVRLLLFPLNAISIKSTTKQQQLQPEIDKLRAKYPGNDA
ESRQLLNAETQKLYKEAGINPYLGCFPMLLQLPFMFALYQAIYSTKQLQDGTFLWMNLSK
ADPYYVMPILAAVFTFMSSYVAQMSAPESSSQSMTKAMMWITPLIVAVPAISFPTAITLY
WVVSSIFSVIQTFILQNPFKYAREQEAKKQAEKERQRKIRRAYKKINRKK

DBGET integrated database retrieval system