KEGG   T30595 (Metagenome): 962
Entry
962               CDS       T30595                                 

Gene name
secE
Definition
preprotein translocase, secE subunit
  KO
K03073  preprotein translocase subunit SecE
Best hit
lpl:lp_0616 (best score: 55.0694)
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.962-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_162:complement(1..150)
AA seq 50 aa
MFKFIKEVIASMKKVTWPTLKQNRRDTSTVVWCSILFAAYLGVLDFIFQQ

KEGG   T30595 (Metagenome): 5860
Entry
5860              CDS       T30595                                 

Gene name
secE
Definition
preprotein translocase, secE subunit
  KO
K03073  preprotein translocase subunit SecE
Best hit
lpl:lp_0616 (best score: 71.2478)
Pathway
02024  Quorum sensing
03060  Protein export
03070  Bacterial secretion system
Other DBs
HMP: SRS047335.5860-T1-C
LinkDB
Position
C127627:1679..1849
AA seq 56 aa
MFKFFKSVGHEMKKVTWPTAKQNRRDTTTVIVTSVLFALFLGALDWAFSTLTQMTF

DBGET integrated database retrieval system