KEGG   T30715 (Metagenome): 1094
Entry
1094              CDS       T30715                                 

Gene name
pyk
Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
spy:SPy_1282 (best score: 395.586)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS077738.1094-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_960:complement(342..1151)
AA seq 269 aa
KIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKVVITATN
MLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPLESVTTMATIDKNAQTLL
NEYGRLNSDSFERNSKTEVMASAVKDATNSMDIKLVVTLTKTGHTARLISKYRPNADILA
LTFDELTERGLMLNWGVIPMLTDAPSSTDDMFEIAERKAVEAGLVQSGDDIVIVAGVPVG
XXXXSLYDGLFFCSWGTYGAKLFTFDLMR

KEGG   T30715 (Metagenome): 11640
Entry
11640             CDS       T30715                                 

Gene name
pyk
Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
spy:SPy_1282 (best score: 226.868)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS077738.11640-T1-C
LinkDB
Position
C269428:3..467
AA seq 155 aa
GESANGKYPLESVRTMATIDKNAQTLLKEYGRLSSVNLSRNSKTEVMASAVKDATNSMNI
KLVVTLTKTGHTARLISKYRPDADILAITFDELTERGLMLNWGVIPVTTDRPSNTDDMFD
LAERIAVEQGLVESGDDIVIVAGVPLGEAVRTNTM

KEGG   T30715 (Metagenome): 12439
Entry
12439             CDS       T30715                                 

Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_07120 (best score: 222.631)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS077738.12439-T1-C
LinkDB
Position
C271638:complement(3..536)
AA seq 178 aa
VILTTQMLYSMVYNPRPTRAEVSDVANAIFDGVDAVMLTEETAIGDYPCEALETVDRIIR
TVEKNNAVDAERFEVEGYKMSISHAVSMTTKHLLEAVDVKSIVTYTKSGTTARFIARYRP
NVPVLAVLPDRESARKLVITRGIVPYIEPKMLSMEEMLSNASEYSKEVGLAEVGDSIL

KEGG   T30715 (Metagenome): 12986
Entry
12986             CDS       T30715                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
rmu:RMDY18_08360 (best score: 344.354)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS077738.12986-T1-C
LinkDB
Position
C273020:complement(3..587)
AA seq 195 aa
MRRAKIVATIGPAIESPEKISEAIKAGLNVARLNMSHGDHAEHQARYDTIRDQSAKLGKD
VAILADLQGPKIRLERFANGKEYLEPGADFTITSEDIEGTAEICGTTYKGLPGDVKLGDK
LLLDDGKIRLEAIEVTPTRVRTRVIVGGPISNNKGINLPGAAVSLPALTEKDANDLRFAL
KMGADIIALSFVRTG

KEGG   T30715 (Metagenome): 14782
Entry
14782             CDS       T30715                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
rmu:RMDY18_08360 (best score: 543.502)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS077738.14782-T1-C
LinkDB
Position
C277343:1..900
AA seq 299 aa
LSFVRTGADVEPVHKIMDEEGIRVPVIAKIEKPQAVENLQDIIDKFDGIMVARGDLGVEL
PFSEVPLVQKKAIDMARRWAKPVIVATQVLESMTDNPVPTRAEVSDCANAILDGADAVML
SGETSVGKYPILTLQAMAEIVKDTEKGGLYRVPELDRKPRTRGGAITRAAVNIADQLDAK
LIVTFTQSGDSARRLARLRPETPIVAFTTSPKVRSFLSMLWGVEAEQVEMITDQEGLFQF
VDEYLLKNGLAEAGDLVVVAAGAPAGRAGTTNMVQVHRVYGAEGERETLRPYEENEVKR

KEGG   T30715 (Metagenome): 2152
Entry
2152              CDS       T30715                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_07120 (best score: 53.5286)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS077738.2152-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_1817:613..738
AA seq 42 aa
MIRNSKIIATIGDATDKVLRKIVEGAADAVLIDSYYGNNEQN

KEGG   T30715 (Metagenome): 4461
Entry
4461              CDS       T30715                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_01590 (best score: 836.254)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS077738.4461-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_3702:2801..4240
AA seq 479 aa
MIQKKTKIICTIGPKSEAKETLTQMVELGMNVCRLNFSHGDYAEHGARIQTIKEVREATG
TNLAILLDTKGPEIRTHNMENDAIMLETGKDVIVSMTEVLGTTEKFSITYGELVHDVKAG
DTILLDDGLIGLTVNKVDAEGGLIYTTIQNGGVLKNKKGVNVPGVSTKLPGITPKDEEDI
RFGCKQDIDFVAASFVRTKENVLEVRRILKEEGCEHVQIIPKIECQEAIDNIDEIIEVSD
GIMIARGDLGVEVPAEEVPIMQKDIIAKCNEAGKFVITATQMLDSMQKNPRPTRAEVSDV
ANAIYDGTDAIMLSGESAAGAYPIESVCTMATIAKRTEEMQDYSRILKERSKKVVSKDIT
NAIGVSVGYTALNLDLHTIVTYTELGKTARLISKYRPNASILAVTPSAKVARGLSLVWGV
DAQISEQAKSTDEMLVTAAKIAKSSGYAKVGDAIVITGGINTSVSNAGTTNFLKVSVID

KEGG   T30715 (Metagenome): 4650
Entry
4650              CDS       T30715                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
spy:SPy_1282 (best score: 173.326)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS077738.4650-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_3852:1..309
AA seq 103 aa
FRFNFSHGDHQEQGDRMATVKLAEKLAGKKVGFLLDTKGPEIRTELFEGEAKEYSYKTGE
KIRVATKQGIKSTRDVIALNVAGALDIYDDVEVGRQVLVDDGK

KEGG   T30715 (Metagenome): 4652
Entry
4652              CDS       T30715                                 

Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_07120 (best score: 327.791)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS077738.4652-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_3854:1..783
AA seq 260 aa
IIVKIDCKDGYDNLDGILEIADAIMINRDELGVDISYEDLPGIQKEIVRRANEAAKVVIL
TTQMLYSMVYNPRPTRAEVSDVANAIFDGVDAVMLTEETAIGDYPCEALETLDRIIRTVE
KNNAVDAERFEVEGYKMSISHAVSMTTKHLLEVVDVKSIVTYTKSGTTARFIARYRPNVP
VLAVLPDRESARKLVITRGIVSYIEPKMLSMEEMLSNASSYSKKVGLAEVGDLILITAGQ
PDRGKGTVPPTDFVYVSKVD

KEGG   T30715 (Metagenome): 5173
Entry
5173              CDS       T30715                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
rmu:RMDY18_08360 (best score: 728.398)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS077738.5173-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_4223:1..1470
AA seq 489 aa
AKIVATIGPAISSPEKIAEAIKAGMNVSRLNMSHGDHDVHTNSYTTIREQSAALGKEVAI
LADLQGPKIRLERFVNGEEYLKPGADFTITSEDVEGTKDICGTTYKGLPGDVKPGDKLLL
DDGKIQLEAVEVTPTRVRTRVIVGGPISNNKGINLPGAAVSLPALTEKDEADLRFALNLG
VDIIALSFVRSGKDVNRVHEIMAEEGIRIPVIAKIEKPQAVDNLQDIIDKFDGIMVARGD
LGVELPFSEVPLVQKKAIEMARRWAKPVIVATQVLESMISSPTPTRAEVSDCANAILDGA
DAVMLSGETSVGNYPIITIAAMASIIRDTEEKGLYRVPQLDRKPRTRGGAITRAAVNIAE
QLDVDYISTFTQTGDSARRLARLRPAQPVLAFTPNPKVRAFISLLWGVEAAHAPVATNID
GTTDIVNDYLVEHKLAEPGDLIVIAAGSPPGVAGSTNMVKVHRIKEQGSGEHEPEEREHL
RPYGEDEHK

KEGG   T30715 (Metagenome): 5760
Entry
5760              CDS       T30715                                 

Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_07120 (best score: 564.688)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS077738.5760-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_4587:282..1433
AA seq 383 aa
MTRKAKIIATLGNSTEGILEEIVAKGADAVLIDTYYGSTEDCIDRINKIKELRDKLDKNT
AIIYDLDHIYAESKYKLIKIEEENVHFACQNNVDFVACPFVSNLDEIRKVKDILQVQGKK
DIGLIVKIDCKEAYESIDEIIQFADSIMINRDELGMELPYENLPSIQKEIIRKANDATVE
VILTTQMLHSMIYNPRPTRAEVSDVANAVIDGVDAIMLIEETATGNYPKEALQTVDKIIS
YIETQDIVLEDEDDEYKNHKMDIAHAISLSTKYLLDSLDVNNIVTYTKSGSTAKFIARYK
PKVQILAVVPSKQKARKLALTRGVTTFIEERTLPMEEMLSLAPKFAKESGLAKKGDFILI
TAGQPDLGKENVPPTDFVNIRQV

DBGET integrated database retrieval system