KEGG   T30715 (Metagenome): 11621
Entry
11621             CDS       T30715                                 

Definition
putative PTS system, membrane component
  KO
K03475  ascorbate PTS system EIIC component
Best hit
spy:SPy_0174 (best score: 251.906)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS077738.11621-T1-C
LinkDB
Position
C269370:3..464
AA seq 154 aa
AGRFGKKEESLDNLKLPKFLSIFHDTVVASATLMLVFFGAILLILGPDIMSNKEVITSGT
LFNPAKQDFFMYIIQTAFTFSVYLFVLMQGVRMFVSELTNAFQGISNKLLPGSFPAVDVA
ASYGFGSPNAVLSGFAFGLIGQLITIVLLIVFKN

KEGG   T30715 (Metagenome): 1270
Entry
1270              CDS       T30715                                 

Definition
putative PTS system, membrane component
  KO
K03475  ascorbate PTS system EIIC component
Best hit
spy:SPy_0174 (best score: 280.796)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS077738.1270-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_1125:complement(2..556)
AA seq 185 aa
MEVISSVLNWFSSNILQNPAFFVGLLVLIGYALLKKPAHDVFSGFVKATVGYMLLNVGAG
GLVTTFRPILAALNYKFQIGAAVIDPYFGLAAANNKIAAEFPDFVGTATTALLIGFGINI
LLVALRKITKVRTLFITGHIMVQQAATVSLMVLFLVPQLRNAYGTAAIGIICGLYWAVSS
NMTVE

KEGG   T30715 (Metagenome): 13155
Entry
13155             CDS       T30715                                 

Gene name
ulaA
Definition
ascorbate-specific PTS system enzyme IIC
  KO
K03475  ascorbate PTS system EIIC component
Best hit
aur:HMPREF9243_0263 (best score: 158.303)
Taxonomy
Firmicutes - Bacilli [GN:aur]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS077738.13155-T1-C
LinkDB
Position
C273442:2..349
AA seq 115 aa
ASGTVVILPGVVPHFFCGATAGVIGNASGGVRGATIGAFLQGILISFLPVFLMPVLGGLG
FQGSTFSDADFGLSGIILGMLNQFGSQAGIVIGLVLILAVMFGVSFIKKPSAKEE

KEGG   T30715 (Metagenome): 2398
Entry
2398              CDS       T30715                                 

Definition
ascorbate-specific PTS system enzyme IIC
  KO
K03475  ascorbate PTS system EIIC component
Best hit
aur:HMPREF9243_0263 (best score: 268.47)
Taxonomy
Firmicutes - Bacilli [GN:aur]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS077738.2398-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_2058:1..543
AA seq 181 aa
GLALGIIMSISPAFVQKYMVQLTGNDKVALGHFSSLGYWLSGFTGSLIGDKSKSTEDIKF
PKSLAFLRDSTVSITLSMAIIYIIVAIFAGSEYIEKEISSGISGLVYALQLAGQFAAGVF
VILAGVRLILGEIVPAFKGISERLVPNSKPALDCPIVYTYAPNAVLIGFISSFVGGLVSM
A

KEGG   T30715 (Metagenome): 733
Entry
733               CDS       T30715                                 

Definition
PTS system, membrane component, putative
  KO
K03475  ascorbate PTS system EIIC component
Best hit
spy:SPy_0174 (best score: 199.134)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS077738.733-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_595:complement(3..356)
AA seq 118 aa
LLIVFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVILSFISGVLQVALGALCVALL
DLASYGGYHGNIDFEFPWLGFGYIFKYLGIVGYVLVCLFLLVIPQLQFAKAKDKEKYY

KEGG   T30715 (Metagenome): 8140
Entry
8140              CDS       T30715                                 

Gene name
sgaT
Definition
PTS system, membrane component, putative
  KO
K03475  ascorbate PTS system EIIC component
Best hit
spy:SPy_0174 (best score: 186.808)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS077738.8140-T1-C
LinkDB
Position
C260057:3..308
AA seq 102 aa
RTLFITGHIMVQQAATVSLMVLLLVPQLRNSWGTLAIGLICGLYWAVSSNMTVEATQRLT
GGGGFAIGHQQQFAIWFVDKVAPFFGKKEENLDNLKLPKFLS

DBGET integrated database retrieval system