KEGG   T30715 (Metagenome): 1646
Entry
1646              CDS       T30715                                 

Gene name
ndk
Definition
nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Best hit
lgr:LCGT_0920 (best score: 67.781)
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04016  MAPK signaling pathway - plant
Other DBs
HMP: SRS077738.1646-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_1472:1..153
AA seq 50 aa
ATRPEEALPGTIRGDFAKAAGENEVIQNVVHGSDSEESAKREIALWFKEK

KEGG   T30715 (Metagenome): 6544
Entry
6544              CDS       T30715                                 

Gene name
ndk
Definition
nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Best hit
lgr:LCGT_0920 (best score: 136.346)
Taxonomy
Firmicutes - Bacilli [GN:lgr]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04016  MAPK signaling pathway - plant
Other DBs
HMP: SRS077738.6544-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_4995:230..547
AA seq 105 aa
MEQTFFIIKPDGVKRGLVGEILQRMEQRGFKLEKLELRSAVSEDLIDQHYQDLVEKSFYP
PIRQFMTSGPVVVGILSGPKVIETWRTMMXXILLRLQETIKPFKM

KEGG   T30715 (Metagenome): 7056
Entry
7056              CDS       T30715                                 

Gene name
ndk
Definition
nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Best hit
rdn:HMPREF0733_12074 (best score: 266.929)
Taxonomy
Actinobacteria [GN:rdn]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04016  MAPK signaling pathway - plant
Other DBs
HMP: SRS077738.7056-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_5190:5106..5519
AA seq 137 aa
MTEKTLILVKPDGVERGLIGEILSRFETKGYVIEGLKMLQPTEELLAQHYAEHAGKPFYR
SLVDFMVSGPVVAAVLSGDRVIEGVRTMLGASDPTTAAPGTIRGDYGRDWDEGVQKNLVH
ASDSPESAAREIALWLS

DBGET integrated database retrieval system