KEGG   T30715 (Metagenome): 16860
Entry
16860             CDS       T30715                                 

Gene name
adk
Definition
adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Best hit
rmu:RMDY18_05010 (best score: 361.303)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00230  Purine metabolism
00730  Thiamine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS077738.16860-T1-C
LinkDB
Position
C281157:1545..2108
AA seq 187 aa
MNRLLIVGPPGAGKGTQAVKIAEALKIPAISTGDIFRKNIKEETELGKEAKSYIDSGNLV
PDSVTNNMVRARLEESDVVNGFLLDGYPRNTSQVHELDSILEAKGEKIDRVLLLVADNDE
LVERLLNRAAEQGRTDDNEEVIRHRLKVYEEETAPLIAIYRERGIVKEVNGLGEIAEVTE
RILDALK

KEGG   T30715 (Metagenome): 1743
Entry
1743              CDS       T30715                                 

Gene name
adk
Definition
adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Best hit
spy:SPy_0074 (best score: 282.722)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00230  Purine metabolism
00730  Thiamine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS077738.1743-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_1536:complement(590..1114)
AA seq 174 aa
MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTEMGVLAKSYIDKGELVP
DEVTNGIVKERLSQDDIKETGFLLDGYPRTXXXXVTGETFHKVFNPPVDYKEEDYYQRED
DKPETVKRRLDVNIAQGEPIIAHYRAKGLVHDIEGNQDINDVFSDIEKVLTNLK

KEGG   T30715 (Metagenome): 17765
Entry
17765             CDS       T30715                                 

Gene name
adk
Definition
adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Best hit
rmu:RMDY18_05010 (best score: 314.309)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00230  Purine metabolism
00730  Thiamine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS077738.17765-T1-C
LinkDB
Position
C282143:1596..2159
AA seq 187 aa
MNRLLIIGPPGAGKGTQAVKIAEELKIPAISTGDIFRKNIKEETELGKEAKSYIDSGNLV
PDSVTNNMVRARLDEADVAHGFLLDGYPRNIAQVHELDAILADKNQQIDRVLLLVADDDE
LVARLLNRAAEQGRTDDNEEVIRHRLKVYEEETAPLVAKYRERGIVKEVDGLGEIADVTE
RILKALS

KEGG   T30715 (Metagenome): 5690
Entry
5690              CDS       T30715                                 

Gene name
adk
Definition
adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Best hit
got:AXE85_00230 (best score: 421.394)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00230  Purine metabolism
00730  Thiamine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS077738.5690-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_4549:536..1189
AA seq 217 aa
MNIILMGLPGAGKGTQAEQIKANYPIPHISTGDMFRAAIKNETPLGKEAKSYIDKGQLVP
DSVTIGLVEERLNQEDAKEGFLLDGFPRTVEQAEALDQILAKTNRKIDKVLNIDVDPAIL
LPRLTGRRICKQCGNTYHMIFNPTKVEGVCDNDGGELYQRSDDNEETVANRLEVNIKQTK
PLLDFYSQKEGVVENINGDQDIKVVFQDVQNILDKLK

KEGG   T30715 (Metagenome): 7751
Entry
7751              CDS       T30715                                 

Gene name
adk
Definition
adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Best hit
spy:SPy_0074 (best score: 84.7297)
Pathway
00230  Purine metabolism
00730  Thiamine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS077738.7751-T1-C
LinkDB
Position
C259031:complement(2..133)
AA seq 44 aa
MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTE

DBGET integrated database retrieval system