KEGG   T30715 (Metagenome): 2752
Entry
2752              CDS       T30715                                 

Definition
phosphotransferase system mannitol/fructose-specific IIA domain
(ntr-type)
  KO
K02821  ascorbate PTS system EIIA or EIIAB component [EC:2.7.1.194]
Best hit
spy:SPy_0176 (best score: 133.65)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS077738.2752-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_2349:154..432
AA seq 93 aa
MHLKQALIDNDSIRLGLEANDWKEAVKVAVDPLIESGAILPEYYDAIIESTEEYGPYYIL
MPGMAMPHARPEAGVQRDAFSLITLQNPVVFSD

KEGG   T30715 (Metagenome): 8313
Entry
8313              CDS       T30715                                 

Gene name
ptxA
Definition
phosphotransferase system sugar-specific EII component, putative
  KO
K02821  ascorbate PTS system EIIA or EIIAB component [EC:2.7.1.194]
Best hit
spy:SPy_0176 (best score: 88.1965)
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS077738.8313-T1-C
LinkDB
Position
C260529:128..313
AA seq 62 aa
MKGREMNLKQALTDNKSIRLGLSAATWQEAVKLAVDPLIESGAVQPQYYDAIVESTEEYG
PY

DBGET integrated database retrieval system