KEGG   T30715 (Metagenome): 542
Entry
542               CDS       T30715                                 

Definition
hypothetical protein
  KO
K03476  L-ascorbate 6-phosphate lactonase [EC:3.1.1.-]
Best hit
spy:SPy_0182 (best score: 667.151)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS077738.542-T1-C
LinkDB
Position
SRS077738_LANL_scaffold_437:1365..2456
AA seq 363 aa
MPNIKEITRESWILATFPEWGTWLNEEIEEEVVPEGNFAMWWLGNCGTWIKTPGGANVVM
DLWSNRGKSTKKVKDMVRGHQMANMAGVRKLQPNLRVQPMVIDPFAINELDYYLVSHFHS
DHIDPYTAAAILNNPKLEHVKFIGPYHCGRIWEGWGVPKERIIVVKPGDTIELKDMKIHA
VESFDRTCLVTLPVNGADETGGELAGLAVTDEEMAQKAVNYIFETPGGTIYHGADSHFSN
YFAKHGKDFKIDVALNNYGENPVGIQDKMTSIDLLRMAENLRTKVIIPVHYDIWSNFMAS
TNEILELWKMRKDRLQYDFHPFIWEVGGKYTYPQDQHLVEYHHPRGFDDCFEQDSNIQFK
ALL

KEGG   T30715 (Metagenome): 8903
Entry
8903              CDS       T30715                                 

Definition
conserved uncharacterized protein
  KO
K03476  L-ascorbate 6-phosphate lactonase [EC:3.1.1.-]
Best hit
slg:SLGD_01534 (best score: 221.09)
Taxonomy
Firmicutes - Bacilli [GN:slg]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS077738.8903-T1-C
LinkDB
Position
C262167:complement(2..334)
AA seq 111 aa
AKHGKDFQIDVAINNYGDNPVGIQDKMTSIDLLRMAENLRAKVIIPVHYDIWSNFMASTD
EILALWKMRKERLQYQFHPFIWEVGGKYTYPLDKDRIEYHHPRGFDDCFEQ

DBGET integrated database retrieval system