KEGG   T30740 (Metagenome): 1105088615441Help
Entry
1105088615441     CDS       T30740                                 

Gene name
JCVI_PEP_1105088615441
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
alv:Alvin_1889 (best score: 269.24)
Taxonomy
Gammaproteobacteria - Others [GN:alv]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105088615441
LinkDB All DBs
AA seq 184 aa AA seqDB search
VLSEGAGILILEQLEHAKTRGAKIYAELGGFGINSDAYHMTAPSPSGVGAASCMQLALND
AGLNVGEIEYINAHGTSTPAGDKAESDAVKALFKDHSSKLAISSTKSMVGHMLGAAGGAE
AVFTVMAIKDQIAPPTINYKTPDPDCDLNCVPNEARQMEINHALSNSFGFGGTNGTLLFS
KFSN

KEGG   T30740 (Metagenome): 1105150207637Help
Entry
1105150207637     CDS       T30740                                 

Gene name
JCVI_PEP_1105150207637
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 478.789)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105150207637
LinkDB All DBs
AA seq 288 aa AA seqDB search
GLQKSSPFTVPMMIPNMATGLAAIALGAKGPSSAVSTACAAGSNAIGDSFRLLQLGKADA
MICGGAEASITPLGVAGFASAKALSFRNESPQTASRPFDAKRDGFVIGEGSGILVLETLE
NAQKRNARIYAEIIGYGTTCDAHHITAPSPGGVGGAEAIKLAIEDACLSLEKVDYINAHG
TSTSANDKNETSAIKSIFRDRSYLIPVSSTKSMTGHLLGGSGGIEAVACILSLTHNFIPP
TINYVNPDPDCDLDYVPNNARDAQVRVALSNSFGFGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105145963233Help
Entry
1105145963233     CDS       T30740                                 

Gene name
JCVI_PEP_1105145963233
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
arb:A9P82_11530 (best score: 103.219)
Taxonomy
Bacteroidetes [GN:arb]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105145963233
LinkDB All DBs
AA seq 90 aa AA seqDB search
MSKRRVVVTGLGTINPLGNNVEDTWENLVNGVSGIDSITSFDTSNLPVTFAGEVKNFDAN
EYMGKQHARKLDRSRHLSIYATEEALKMLS

KEGG   T30740 (Metagenome): 1105112903697Help
Entry
1105112903697     CDS       T30740                                 

Gene name
JCVI_PEP_1105112903697
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
mca:MCA1999 (best score: 231.491)
Taxonomy
Gammaproteobacteria - Others [GN:mca]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105112903697
LinkDB All DBs
AA seq 183 aa AA seqDB search
ASWQDGSGLVMLEEYEHAKKRGARIYAELIGSGMSGDAHHITSPSIDGPVICMEMALKNS
GINPEDIDYINAHGTSTQQNDINETNAIKRVFGNYSQNLLVSSTKSITGHLLGAAGGLEA
GITSLALCEGVVPPTINLDNPQEGCDLNYVPHKSLDSNIKIALSNSFGFGGTNCTLIFKK
FEN

KEGG   T30740 (Metagenome): 1105132757191Help
Entry
1105132757191     CDS       T30740                                 

Gene name
JCVI_PEP_1105132757191
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
caci:CLOAM0251 (best score: 164.466)
Taxonomy
Cloacimonetes [GN:caci]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105132757191
LinkDB All DBs
AA seq 129 aa AA seqDB search
IKALSKANLNFKEINYINAHGTSTPANDKAETLAIKNVFNDHAYNLKINSTKSIIGHSSG
AAGAMEAIACAKSIKEQKIHGTINYNTPDPECDLDYNPNKSTNYEINYALSNSFGFGGHN
SCIILSKFS

KEGG   T30740 (Metagenome): 1105083980086Help
Entry
1105083980086     CDS       T30740                                 

Gene name
JCVI_PEP_1105083980086
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
fsi:Flexsi_0118 (best score: 359.377)
Taxonomy
Deferribacteres [GN:fsi]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105083980086
LinkDB All DBs
AA seq 314 aa AA seqDB search
ILAFVQFAIAAAGQAIEDAKFPSGLSRMDWGSAIGVGIGDIKNIYETSDTIRSKGPKRVS
PFFIPYVIANMAAGNTAQHYGLKGPNICPTTACTSGTHAVGEAFMYIQTGRAKVMVCGGS
EAAVTELTVAGFSNMKALSRNNDNPAKASRPFDANRDGFVIGEGSGVLVLEEYEHAVKRG
AKIYAEVVGYGLSCDAYHITSPAPKGEGAQRCMKQALETAAVLPEQIDYINAHGTSTYYN
DVYETEAIEEVFSDHSKNLSVSSTKGVTGHCLGAAGGIEALFLAKAISEGVIPPTANLET
PDEKCSFRLTLQPG

KEGG   T30740 (Metagenome): 1105139094821Help
Entry
1105139094821     CDS       T30740                                 

Gene name
JCVI_PEP_1105139094821
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
vai:BU251_05395 (best score: 179.874)
Taxonomy
Other [GN:vai]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105139094821
LinkDB All DBs
AA seq 206 aa AA seqDB search
IMSKRRVVITGLGTINPLGNNVTDSWEKLINGISGIDNITSFDTGDLPVTFAGEVKNFDA
NEYMGKQHARKLDRSGHLSIYAAEQALLDAGFNPEERMGSNCGIVFGTGIGGIGATEDAV
RVYDERGASRINPLAITQLMPNSSTGQVAIKFGIEGPSLTITTACAASANAVGEAKNMIE
NGIVDIVVAGGTESGTTPMTIGAFAQ

KEGG   T30740 (Metagenome): 1105146892025Help
Entry
1105146892025     CDS       T30740                                 

Gene name
JCVI_PEP_1105146892025
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
txi:TH3_12290 (best score: 333.954)
Taxonomy
Alphaproteobacteria [GN:txi]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105146892025
LinkDB All DBs
AA seq 240 aa AA seqDB search
LSIRYGDADVMIAGGAEAACCRIGMAGFAAARALSTNFNDDPKSSSRPWDQDRDGFIMGE
GAGVVVLEEKEHAISRGAKIYAEIKGYGMSGDAHHITAPAENGDGGYRAMLSAINDAGIN
SSDLDYINAHGTSTPLGDIIELKAIGRLLKQKIQNTSISSTKSATGHLLGAAGAIEAIFS
ILSIVNQTVPPTNNLVNPDKETIGFDLVPLKAKSRIIKNVLSNSFGFGGTNASLVIGNSD

KEGG   T30740 (Metagenome): 1105102136331Help
Entry
1105102136331     CDS       T30740                                 

Gene name
JCVI_PEP_1105102136331
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ate:Athe_1158 (best score: 305.834)
Taxonomy
Firmicutes - Clostridia [GN:ate]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105102136331
LinkDB All DBs
AA seq 264 aa AA seqDB search
IKYGIQGPSLTITTACAASANAIGEAKRMIEQNIVDKVLVGGTESGTTSMTIGAFAQIKA
LSKQNDEPQKACKPFDKNRDGFVMAEGSTVLILESESSAKDRDAKIYGYISGYGSSTDAY
HITAPSEGGVGALRAMEQAISNADISKEKIDYINAHGTSTPANDLNETLAIKSLMNDYAY
EVNISSTKSMTGHLLGGGGAFEAMASLLSMKNSLIPPTINLNDSDEDCDLNYTANHSIEK
NIDHAMSNSFGFGGHNAVLIFSKQ

KEGG   T30740 (Metagenome): 1105075772765Help
Entry
1105075772765     CDS       T30740                                 

Gene name
JCVI_PEP_1105075772765
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
hel:HELO_2000 (best score: 426.787)
Taxonomy
Gammaproteobacteria - Others [GN:hel]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105075772765
LinkDB All DBs
AA seq 344 aa AA seqDB search
VRVLQLRRLDTFVQYGVSAGIQAIEDAGLDNVDKDRIGLNIGSGIGGLDSIEKNKDILNK
KSFKRVSPFFVPGSIINMTPGYLSIIKGYTGPNLSIVTACASSNHAIGTSARLIAYGDAD
VMVTGGSEMATTPLGVSGFLASRALSKSDDPKIASRPWDKDRDGFVLSDGAAILILEEYE
HAKNRSANIYAEIIGFGMSSDAYHMTAPSEDGTGASLSISRAISDAGISTNDIDYINAHA
TSTPLGDLAECNAVKSIFDSPPPISSTKSMTGHTLGAAGAIESIFSILSIVNNISPPTIN
LNNPDERCDLDFIPNEARDMKIDISLNNSFGFGGTNSTLIFKSV

KEGG   T30740 (Metagenome): 1105145963725Help
Entry
1105145963725     CDS       T30740                                 

Gene name
JCVI_PEP_1105145963725
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
lap:ACP90_17240 (best score: 119.012)
Taxonomy
Alphaproteobacteria [GN:lap]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105145963725
LinkDB All DBs
AA seq 105 aa AA seqDB search
MKRVVVTGIGLVTPLGCGTDINWKNLISGVSGAKKISKFDASNYKCQVACEVPVDSKIEG
SFVPEEWIDKKELKKLDEFIKYSLVAGEEAFQQSKLMSMKSLQPY

KEGG   T30740 (Metagenome): 1105114557405Help
Entry
1105114557405     CDS       T30740                                 

Gene name
JCVI_PEP_1105114557405
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
dae:Dtox_1182 (best score: 343.969)
Taxonomy
Firmicutes - Clostridia [GN:dae]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105114557405
LinkDB All DBs
AA seq 274 aa AA seqDB search
MPNSSTGQVAIKFGIEGPSLTITTACAASANAVGEAKNLIENGIVDIVVAGGTESGTTPM
TIGAFAQIRALSTKNDSPESACSPFDKDRDGFVMAEGSTVLVLEEEESAKKRGAKIYGYV
TGYGSTTDAHHITAPAEGGEGAVRAMDKAIKDAGVGFQGIDYINAHGTSTPANDKNETLA
LKTLFGESAYEVDISSTKSMTGHLLGGAGAFESMVCLLSMQNNVIPPTINLVSNDEDCDL
NYTPNKSINKEVNIAMSNSFGFGGHNGVLVFSKE

KEGG   T30740 (Metagenome): 1105114995807Help
Entry
1105114995807     CDS       T30740                                 

Gene name
JCVI_PEP_1105114995807
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 322.783)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105114995807
LinkDB All DBs
AA seq 242 aa AA seqDB search
MPNFHRVVITGIGAVTPIGNNIDEYLVGLQTGTNGVSDITLFDPEQHPCKFAAEVKNLQS
HDFIEAKESKRWDRFSQFGVIAAKQAFNDSGLEITEANASRIGVIIGSGVGGLLTMESQA
QILSHKGPKRVSPFTVPMMIPNMATGLAAIALGAKGPSSSVSTACAAGSNAIGDSFRLLQ
LGKADAMICGGAEASITPLGVAGFASAKALSFRMKVLKLPADLLMQKEMDLLLEKGSWNS
CF

KEGG   T30740 (Metagenome): 1105104743195Help
Entry
1105104743195     CDS       T30740                                 

Gene name
JCVI_PEP_1105104743195
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ttm:Tthe_1491 (best score: 355.91)
Taxonomy
Firmicutes - Clostridia [GN:ttm]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105104743195
LinkDB All DBs
AA seq 293 aa AA seqDB search
IIKNKGARRVSPQFVAKMIPNIAGGHVSMRFGFRGPSQTVISACASSNDAIGIALRLIRY
GDADIMLTGGTEASITPLTIAGFANMRALSQNCDNPTEASRPFDANRDGFVLSEGAGMLV
IESEEHALKRGATILAELAGYGSSDDAFHITQPAPEGLGAFKAMKRALEDASITTEDIDY
INAHGTSTPFNDKNESKAIGNLFKDTLHKLKVSSTKSMTGHLLGAAGGLEAVATVKSIIN
NKIAPTINYKNPDPECTLDYTPNNAVSHTINAALSNTFGFGGHNAVLCFRKYN

KEGG   T30740 (Metagenome): 1105105683145Help
Entry
1105105683145     CDS       T30740                                 

Gene name
JCVI_PEP_1105105683145
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 274.633)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105105683145
LinkDB All DBs
AA seq 192 aa AA seqDB search
MPNFHRVVITGIGAVTPIGNNIDEYLVGLQTGTNGVSDITLFDPEQHPCRFAAEVKNLQS
ENFIEAKESKRWDRFSQFGVIAAKQAFNDSGLEITEANASRIGVIIGSGVGGLLTMESQA
QILSHKGPKRVSPFTVPMMIPNMATGLAAIALGARGPSSSVSTACAAGSNAIGDSFRLLQ
LGKADAILATSH

KEGG   T30740 (Metagenome): 1105130691187Help
Entry
1105130691187     CDS       T30740                                 

Gene name
JCVI_PEP_1105130691187
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
sgy:Sgly_3032 (best score: 43.5134)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105130691187
LinkDB All DBs
AA seq 79 aa AA seqDB search
LQEKLKTLMQMNIWENKMQESWDRSGHLSIFAAEEAIQDAGFDLSKPLGEDFGIVFGTGI
GWNRSNGDAGRVTMKRITG

KEGG   T30740 (Metagenome): 1105146944125Help
Entry
1105146944125     CDS       T30740                                 

Gene name
JCVI_PEP_1105146944125
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
anx:ACH33_07080 (best score: 400.979)
Taxonomy
Firmicutes - Bacilli [GN:anx]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105146944125
LinkDB All DBs
AA seq 345 aa AA seqDB search
DATDHRAKIAGEVKDFDLSLALDSKEVRTNDPFTHYGVYAATQAVADSGLIVDERNAERV
GVIWGSGIGGIATHEQQHSVLMEKGPKRISPFLVPMMIIDMAAGMISMKLGAKGPNFATV
SACASASHAIGEAARKIQYGDADVMITGGSEAAVTATSVGGFASSRALSMRNDEPTRASR
PFDKDRDGFVMGEGAGAIVLEELGAAQARGATIYGEFLGLGFTADAYHQTAMAPEAEGGT
RAIGLALADAGLGRESIDYINAHGTSTPMGDSQETAAIKNSFGDHARSLAVSSTKSMTGH
LLGAAGAIETVACLMAIKEGVVPPTINYETPDPECDWTTANCKPY

KEGG   T30740 (Metagenome): 1105149743361Help
Entry
1105149743361     CDS       T30740                                 

Gene name
JCVI_PEP_1105149743361
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ntr:B0W44_07075 lfb:C1X05_10850 bsu:BSU11340 (best score: 65.4698)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105149743361
LinkDB All DBs
AA seq 72 aa AA seqDB search
LSYTTNCVTFIYHLNILTVENVNTNSTRVVITGMGIISPLGNDVDNFWDKLIHGISGIGP
MTLCDTTDYPCK

KEGG   T30740 (Metagenome): 1105149533971Help
Entry
1105149533971     CDS       T30740                                 

Gene name
JCVI_PEP_1105149533971
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 467.233)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105149533971
LinkDB All DBs
AA seq 277 aa AA seqDB search
MMIPNMATGLAAIALGAKGPSSSVSTACAAGSNAIGDSFRLLQLGKADAMICGGAEASIT
PLGVAGFASAKALSFRNDSPQTASRPFDAERDGFVIGEGSGILVLETLENAQKRNARIYA
EIIGYGTTCDAHHITAPSPGGVGGAEAIKLAIEDACLSLEKVDYINAHGTSTSANDKNET
SAIKSIFRDRSYLIPVSSTKSMTGHLLGGSGGIEAVACILSLTHNFIPPTINYVNPDPEC
DLDYVPNNAREAQIGVALSNSFGFGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105083349212Help
Entry
1105083349212     CDS       T30740                                 

Gene name
JCVI_PEP_1105083349212
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 465.692)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105083349212
LinkDB All DBs
AA seq 279 aa AA seqDB search
VPMMIPNMATGLAAIALGAKGPSSSVSTACAAGSNAIGDSFRLIQLGKADAMICGGAEAS
ITPLGVAGFASAKALSSRNDSPQTASRPFDAERDGFVIGEGSGILVLETLENAQKRNARI
YAEIVGYGTTCDAHHITAPSPGGVGGAEAIKLAIEDACLSLDKVDYINAHGTSTSANDKN
ETSAIKSIFKDRSYLIPVSSTKSMTGHLLGGSGGIEAVACILSLTHNFIPPTINYVNPDP
ECDLDYVPNNAREAQVRVTLSNSFGFGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105142322389Help
Entry
1105142322389     CDS       T30740                                 

Gene name
JCVI_PEP_1105142322389
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
kol:Kole_0973 (best score: 178.718)
Taxonomy
Thermotogae [GN:kol]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105142322389
LinkDB All DBs
AA seq 206 aa AA seqDB search
LIMSKRRVVITGLGTINPLGNNVADSWEKLINGISGIDDITSFDTGDLPVTFAGEVKNFD
ANEYMGKQHARKLDRSGHLSIYAAEQALLDAGFNPEERMGSNCGIVFGTGIGGIGATEDA
VRVYDERGPSRINPLAITQLMPNSSTGQVAIKFGIEGPSLTITTACAASANAVGEAKNMI
ENGIVDIVVAGGTESGTTPIQSSRTP

KEGG   T30740 (Metagenome): 1105149009703Help
Entry
1105149009703     CDS       T30740                                 

Gene name
JCVI_PEP_1105149009703
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
tye:THEYE_A0103 (best score: 111.309)
Taxonomy
Nitrospirae [GN:tye]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105149009703
LinkDB All DBs
AA seq 84 aa AA seqDB search
ILVSSTKSMTGHLLGAAGAIESIFSILSLNDNVIPPTINLENPDNEANLRLVAKETVSKK
INHVMNNTFGFGGTNVSLIFKKFE

KEGG   T30740 (Metagenome): 1105134464188Help
Entry
1105134464188     CDS       T30740                                 

Gene name
JCVI_PEP_1105134464188
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
anx:ACH33_07080 (best score: 388.267)
Taxonomy
Firmicutes - Bacilli [GN:anx]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105134464188
LinkDB All DBs
AA seq 326 aa AA seqDB search
IGLDRDSTWKSITTGKSGIKKISSFDTENFQTKIAAEITDFSPNEILGRKFASRLDRFAQ
FACVTAKEAIKDSGIYLDAINLERFAVLIGSGIGGIKTLSDQFNVLSEKGPSRISPFLVP
MMLSDMASGQVSMMLGTKGPNFSTVSACASAADSIGQGLHMIRRGEADIVLAGGSEAAIC
PVGIAGFNSARALSTNNDNPKEASRPFDAKRDGFVLGEGAGLIVLEDEEHALKRGATIIC
ELSGYGATSDAHHVTQPHPEGEGASKAMDIAISDAGIEKEKVAYINAHGTSTQLNDKFET
IAIKKSFGDHAKKLKISSTKSMTGHY

KEGG   T30740 (Metagenome): 1105131601623Help
Entry
1105131601623     CDS       T30740                                 

Gene name
JCVI_PEP_1105131601623
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 223.787)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105131601623
LinkDB All DBs
AA seq 169 aa AA seqDB search
MPNFHRVVITGIGAVTPIGNNIDEYLVGLQTGTNGVSDITLFDPEQHPCKFAAEVKNLQS
ENFIEAKESKRWDRFSQFGVIAAKQAFNDSGLEITEANASRIGVIIGSGVGGLLTMESQA
QILSHKGPKRVSPFTVPMMIPNMATGLAAIALGAKGPSPLFHRCAAPAY

KEGG   T30740 (Metagenome): 1105138886513Help
Entry
1105138886513     CDS       T30740                                 

Gene name
JCVI_PEP_1105138886513
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 238.81)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105138886513
LinkDB All DBs
AA seq 204 aa AA seqDB search
MPNFHRVVITGIGAVTPIGNNIDEYLVGLQTGTNGVSDISLFDPEQHPCKFAAEVKNLQS
ENFIEAKESKRWDRFSQFGVIAAKQAFNDSGLEITEANASRIGVIIGSGVGGLLTMESQA
QILSHKGPKRVSPFTVPMMIPNMATGLAAIALGAKGPSSSVSTACAAVQMPSVILLDYSS
LKSRCNDLWGSRSQYYTSGSSRFC

KEGG   T30740 (Metagenome): 1105163527621Help
Entry
1105163527621     CDS       T30740                                 

Gene name
JCVI_PEP_1105163527621
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pcf:106793129 (best score: 30.0314)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105163527621
LinkDB All DBs
AA seq 79 aa AA seqDB search
YGLSGDGCRVIAPSRSVVTALLIHLQAVLKPAMMVTKMLVTAVAQTVPLRPAVMEFLIPQ
RAVTTETLSMVMDVTQTAP

KEGG   T30740 (Metagenome): 1105079891831Help
Entry
1105079891831     CDS       T30740                                 

Gene name
JCVI_PEP_1105079891831
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
amt:Amet_2753 (best score: 282.337)
Taxonomy
Firmicutes - Clostridia [GN:amt]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105079891831
LinkDB All DBs
AA seq 263 aa AA seqDB search
IVEILSFEDQSQSVISACASSNDAIGIALRLIRYGDAEIMLTGGTEASITSLTIAGFANM
RALSQNCDNPTQASRPFDADRDGFVLSEGAGMLVIEFEEHALNRGAPILAELAGYGSSDD
AFHITQPAPEGLGAFKAMKRALEDASISSEDIDYINAHGTSTPFNDKNESKAIENLFKKT
LDKLKVSSTKSMTGHLLGAAGGLEAVATVKSIVKSKIAPTINYKTPDPECSLDYTPNFSA
PHTINAALSNTLDSEVIIQLQAY

KEGG   T30740 (Metagenome): 1105155110039Help
Entry
1105155110039     CDS       T30740                                 

Gene name
JCVI_PEP_1105155110039
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
mtt:Ftrac_1172 (best score: 272.707)
Taxonomy
Bacteroidetes [GN:mtt]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105155110039
LinkDB All DBs
AA seq 186 aa AA seqDB search
MQLKRVVVTGLGALTPLGNNLNSYWDGLTKGVSGAGPITRFDPEKFRTKFACEVKNYDPL
DHFDRKESRKMDLFTQYALVTAEEAMADSGLNLEQIDTNKAGVIWGSGIGGIRTFQQEVE
GFIANDRAPRFNPFFIPKMISDIAAGMISIKYGFHGPNFVTVSACASATNAMIDAMTTST
PPAPPP

KEGG   T30740 (Metagenome): 1105121478497Help
Entry
1105121478497     CDS       T30740                                 

Gene name
JCVI_PEP_1105121478497
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 481.1)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105121478497
LinkDB All DBs
AA seq 327 aa AA seqDB search
VMIFSRSSTGTNGVSDITLFDPEKHPCKFAAEVKNLKSDNFIEAKESKRWDRFSQFGVIA
AKQAFNDSGLEITEDNASRIGVIIGSGVGGLLTMESQAQILSHKGPRRVSPFTVPMMIPN
MATGLAAIALGAKGPSSSVSTACAAGSNAIGDSFRLLQLGKADAMICGGAEASITPLGVA
GFASAKALSSRNDSPQTASRPFDAERDGFVIGEGSGILVLETLENAEKRNARIYAEIVGY
GTTCDAHHITAPSPGGVGGAEAIKLAIEDACLSLEKVDYINAHGTSTSANDKNETSAIKS
IFKDRSYLIPVSSTKSMTGHLLEAQEV

KEGG   T30740 (Metagenome): 1105146892981Help
Entry
1105146892981     CDS       T30740                                 

Gene name
JCVI_PEP_1105146892981
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
phl:KKY_1016 (best score: 220.32)
Taxonomy
Alphaproteobacteria [GN:phl]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105146892981
LinkDB All DBs
AA seq 178 aa AA seqDB search
LSDGSGIVVLEEMEHAKKRGANIYAELIGYGMSGDAYHITAPADDGDGGFRAMQAALKMG
NYSSDEIDYINAHGTSTIKGDEIELNAISRLFKQNIFVSSTKSSIGHLLGAAGSVEAIFS
IMSLNNNILPATLNLDNPISINNINLIPKEPIDKKIKIALSNSFGFGGTNTALLFKSI

KEGG   T30740 (Metagenome): 1105151463807Help
Entry
1105151463807     CDS       T30740                                 

Gene name
JCVI_PEP_1105151463807
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 278.87)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105151463807
LinkDB All DBs
AA seq 182 aa AA seqDB search
IGEGSGILVLETLENAQKRDARIYAEIVGYGTTCDAHHITAPSPGGIGGAEAIKIAIEDA
SLSLEKVDYINAHGTSTSANDKNETSAIKSIFRDRSYLIPVSSTKSMTGHLLGGSGGIEA
VACILSLTHNFIPPTINYVNRDPECDLDYVPNIAREAQVGVALSNSFGFGGHNVCLAFSK
MN

KEGG   T30740 (Metagenome): 1105131113909Help
Entry
1105131113909     CDS       T30740                                 

Gene name
JCVI_PEP_1105131113909
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 479.174)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105131113909
LinkDB All DBs
AA seq 309 aa AA seqDB search
MPNFHRVVITGIGAVTPIGNNIDEYLFGLQKGTNGVSDITLFNSEQHPCKFAAEVKNLQT
ENFIEAKESKRWDRFSQFGVIAAKQAFSDSGLEITEANSSRIGVIIGSGVGGLLTMESQA
QILSHKGPKRVSPFTVPMMIPNMATGLAAIALGAKGPSSSVSTACAAGSNAIGDSFRLLQ
LGKADAMICGGAEASITPLGVAGFASAKALSFRNESPQTASRPFDAERDGFVIGEGSGIL
VLETLENAQKRNAKIYAEIIGYGTTCDAHHITAPSPGGVGGAKAIKLAIEDASLSLEKVD
YINAHGTST

KEGG   T30740 (Metagenome): 1105097248483Help
Entry
1105097248483     CDS       T30740                                 

Gene name
JCVI_PEP_1105097248483
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
cthi:THC_0263 (best score: 182.185)
Taxonomy
Thermodesulfobacteria [GN:cthi]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105097248483
LinkDB All DBs
AA seq 218 aa AA seqDB search
MTKQRVVVTGLGTINPLGNNVIDTWNNLTSGVSGIDHITLFDASDLPVTFAGEVKNFDAN
EYMGKQNARKLDRSGHLSIFAAEEAIQDAGFDLSKPLGEDFGIVFGTGIGGIGATEDAVR
VYDERGSTRISPLAITQLMPNSSTGQVAIKYGIQGPSLTITTACAASANAIGEAKRMIEQ
NIVDKVLVGGTESGTTSMTIGAFAQIKALPNRMIALKT

KEGG   T30740 (Metagenome): 1105087219869Help
Entry
1105087219869     CDS       T30740                                 

Gene name
JCVI_PEP_1105087219869
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
efa:EF0283 (best score: 267.314)
Taxonomy
Firmicutes - Bacilli [GN:efa]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105087219869
LinkDB All DBs
AA seq 259 aa AA seqDB search
MSREKIVITGLGAVTPNGNNVDEYWANLISGVSGIGPITYFDSSNHRVKIAGQLTDFDPE
TILDAKEIRKLDPFSVYALVATEEAIKMSGLDNIQFNQDRIGVTIGTGVGGIQTLEDQQR
VIDQKGARRVSPQFVPKMIANIAGGHLSMRWNLKGPNQTVTSACASATDAIGMAMRLILA
GDADAMITGGTEASITGLTIAGFANMRALSQSNENPTSASRPFDKDRNGFVLGEGSGMIV
IETESHAKKRGANILRLKP

KEGG   T30740 (Metagenome): 1105109165157Help
Entry
1105109165157     CDS       T30740                                 

Gene name
JCVI_PEP_1105109165157
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 227.254)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105109165157
LinkDB All DBs
AA seq 149 aa AA seqDB search
NRPASITAPSPGGVGGAKAIKLAIEDAGLSLGKVDYINAHGTSTSANDKNETSAIKSIFR
DRSYLIPVSSTKSMTGHLLGGSGGIEAVACILSLTHNFIPPTINYVNPDPECDLDYVPNN
AREAQIGVALSNSFGFGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105151605007Help
Entry
1105151605007     CDS       T30740                                 

Gene name
JCVI_PEP_1105151605007
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ttm:Tthe_1491 (best score: 381.719)
Taxonomy
Firmicutes - Clostridia [GN:ttm]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105151605007
LinkDB All DBs
AA seq 301 aa AA seqDB search
RPVAQQIYNERGQRRVSPFFVPRMIANIAAGNLAIEFGLKGPNHTVISACASGTDAIGCA
ARTIQYGDADVIVTGGTEASITGLTISGFANIRALSTQNDYPSKASKPFDKDRDGFVLSE
GSATIVLEELEHAKKRGAKIIAEFAGYGSTDDAYHVTQPSEGGVGAIKAMSNALKDSNLN
TSDIDYINAHGTSTPFNDKTESSAIKNLFSEHSKNLKISSTKSMIGHSLGASGALEAIAS
ILAIQNNKIPPTINYKTPDPECDLDYVPNVSVKQNVDAVMSNSFGFGGHNGVIIFKKWND
Q

KEGG   T30740 (Metagenome): 1105141673589Help
Entry
1105141673589     CDS       T30740                                 

Gene name
JCVI_PEP_1105141673589
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 522.702)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105141673589
LinkDB All DBs
AA seq 352 aa AA seqDB search
VLQFSAIHRVVITGIGAVTPIGNNIDEYLVGLQKGTNGVSNITLFDPEQHPCKFAAEVKN
LQSQDFIEAKESKRWDRFSQFGVIAAKQAFNDSGLKITETNASRIGVIIGSGVGGLLTME
SQAQILSHKGPKRVSPFTVPMMIPNMATGLAAIALGAKGPSSSVSTACAAGSNAIGDSFR
LLQLGKADAMICGGAEASITPLGVAGFASAKALSFRNESPQTASRPFDAERDGFVIGEGS
GILVLETLENAQKRNARIYAEIIGYGTTCDAHHITAPSPGGVGGAKAIELAIQDACLSLE
KVDYINAHGTSTSANDKNETSAIKSIFRDRSYLIPVSSTKSMTGHLLEAQEV

KEGG   T30740 (Metagenome): 1105137821455Help
Entry
1105137821455     CDS       T30740                                 

Gene name
JCVI_PEP_1105137821455
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
hel:HELO_2000 (best score: 181.03)
Taxonomy
Gammaproteobacteria - Others [GN:hel]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105137821455
LinkDB All DBs
AA seq 153 aa AA seqDB search
IHLNSRRVVVTGLGLLTPVGNCVKSSWEAIREGKSGIAPIEHFDVESFGTRFGGSLKDFD
SSKYIEPKDSRRMDIFMQYGIAAGVQAFDDSGLTTDKYNPDRCGVTVGSGIGGIKTIEET
SLQIRDSGPRKVSPFFVPGSIINMIREIFSASY

KEGG   T30740 (Metagenome): 1105151599113Help
Entry
1105151599113     CDS       T30740                                 

Gene name
JCVI_PEP_1105151599113
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 152.14)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105151599113
LinkDB All DBs
AA seq 95 aa AA seqDB search
IKSIFKDRSYLIPVSSTKSMTGHLLGGSGGIEAVACILSLTHNFIPPTINYVNPDPECDL
DYVPNNAREALVRVALSNSFGFGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105161308579Help
Entry
1105161308579     CDS       T30740                                 

Gene name
JCVI_PEP_1105161308579
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
mro:MROS_2456 (best score: 175.252)
Taxonomy
Chlorobi [GN:mro]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105161308579
LinkDB All DBs
AA seq 129 aa AA seqDB search
MKQAISNADINKEKIDYINAHGTSTPANDLNETLAIKSLMNDYAYEVNISSTKSMTGHLL
GGGGAFEAMASLLSMKNNQIPPTINLNDSDEDCDLNYTPNHSLDKNIDHVMSNSFGFGGH
NAVLIFSKE

KEGG   T30740 (Metagenome): 1105103087375Help
Entry
1105103087375     CDS       T30740                                 

Gene name
JCVI_PEP_1105103087375
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
dsu:Dsui_2450 (best score: 293.508)
Taxonomy
Betaproteobacteria [GN:dsu]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105103087375
LinkDB All DBs
AA seq 272 aa AA seqDB search
MQLPRRVVVTGMGLISPLGNSVNESWSNCIKGCSGISENVVNLEDMPIKVGGRIHDFDPT
QYIDSKDIRRLDTFVQYGVSAGIQAIEDAGLDNNVDKDRVGLNIGSGIGGLDSIEKNKDI
LNKKSFKRVSPFFVPGSIINMTPGYLSIVKGYTGPNLSIVTACASSNHAIGTSARLIAYG
DADVMVTGGSEMATTPLGISGFLASRALSKSDDPKTASRPWDKDRDGFCIVRWSSNFSIR
RYDMLKKDQRYLCRVIGFGMSSDAYHMTAPLR

KEGG   T30740 (Metagenome): 1105133794677Help
Entry
1105133794677     CDS       T30740                                 

Gene name
JCVI_PEP_1105133794677
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ttm:Tthe_1491 (best score: 334.339)
Taxonomy
Firmicutes - Clostridia [GN:ttm]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105133794677
LinkDB All DBs
AA seq 280 aa AA seqDB search
IAITQLMPNSSTGQVAIKFGIEDHSVTITTACAASANAVGEAKNMIENGVVDIVVTGGTE
SGTTPMTIAAFAQIRALSTQNESPKEACKPFDKNRDGFVMGEGSTVLILESEESAKSRNA
EIYAYIDGYGSTTDAYHITAPAEGGAGAVKAMEKAIEDAGITPSDIDYINAHGTSTPAND
KNETEAIKTVLGEKASEVVISSTKSMTGHLLGGGGAFESMASILSIKHNKVPPTINLNDP
DEECDLNYTPNNAVDLSINTAMSNSFGFGGHNAVLVFSKS

KEGG   T30740 (Metagenome): 1105139420093Help
Entry
1105139420093     CDS       T30740                                 

Gene name
JCVI_PEP_1105139420093
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
aae:aq_1717 (best score: 343.584)
Taxonomy
Aquificae [GN:aae]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105139420093
LinkDB All DBs
AA seq 343 aa AA seqDB search
IIRIMSKRRVVVSGLGTINPLGNNVSGSWEKLINGVSGIDFITSFDTEDLPVKFAGEVKD
FDANEYMGKQHARKLDRSAHLSIFATEQALRDANLNTEERLGSNVGIVFGTGIGGIGATE
NAVRTYDERGASRINPLAITQLMPNSSTGQVAIKFGIEGPSLTITTACAASANAVGEAKN
LIENGIVDIVVAGGTESGTTPMTIGAFAQIRALSTKNDSPESACSPFDKDRDGFVMAECS
TVLVLEEEESAKKRDAKIYGYVTGYGSTTDAHHITAPAECGEGAVRAMDKAIKDAGVQFK
DIDYINAHGTSTPANDKNETLAIKTLFGERAYEVDISSTKSMT

KEGG   T30740 (Metagenome): 1105088610403Help
Entry
1105088610403     CDS       T30740                                 

Gene name
JCVI_PEP_1105088610403
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 143.28)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105088610403
LinkDB All DBs
AA seq 125 aa AA seqDB search
MPNFHRVVITGIGAVTPIGNSIDEYLVGLQAGTNGVSDITLFNPEQHPCKFAAEVKNLQS
ENFIEAKESKRWDRFSQFGVIAAKQAFNDSGLEITEDNASRIGVIIGFWCWRLTNYGKSS
SNIES

KEGG   T30740 (Metagenome): 1105083444540Help
Entry
1105083444540     CDS       T30740                                 

Gene name
JCVI_PEP_1105083444540
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
dae:Dtox_1182 (best score: 350.517)
Taxonomy
Firmicutes - Clostridia [GN:dae]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105083444540
LinkDB All DBs
AA seq 351 aa AA seqDB search
VLIPEIFPVTFAGEVKNFDANEYMGKQHARKLDRSGHLSIYAAEQALLDAGFNPEERMGS
NCGIVFGTGIGGIGATEDAVRVYDERGASRINPLAITQLMPNSSTGQVAIKFGIEGPSLT
ITTACAASANAVGEAKNMIENGIVDIVVAGGTESGTTPMTIGAFAQIRALSTKNDTPAEA
CSPFDKNRDGFVMAEGSTVLILESEESAKSRDAKIYGYVVGYGSTTDAHHITAPAEGGEG
AVRAMDKALKDASLSVDDVDYINAHGTSTPANDKNETSAIKTLFGTKAYEVDISSTKSMT
GHLLGGAGAFESMVCILSLQNGVIPPTINLNNKDEECDLNYTPINAVISNL

KEGG   T30740 (Metagenome): 1105103833783Help
Entry
1105103833783     CDS       T30740                                 

Gene name
JCVI_PEP_1105103833783
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 394.43)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105103833783
LinkDB All DBs
AA seq 268 aa AA seqDB search
MPKFHRVVVTGIGAVTPIGNNIDEYLLSLQKGTNGVSHITLFDPEQHPCKFAAEVKNLQS
ENFIEAKESKRWDRFSQFGVIAAKQAFNDSGLEITEANASRIGVIIGSGVGGLLTMESQA
QILSHKGPKRVSPFTVPMMIPNMATGLAAIALGAKGPSSSVSTACAAGSNAIGDSFRLLQ
LGKADAMICGGAEASITPLGVAGFASAKALSFRNESPQTASRPFDAERDGFVIGEGSGIL
VLETLENAKKRNARIYAEIMDMTHFTPE

KEGG   T30740 (Metagenome): 1105085702838Help
Entry
1105085702838     CDS       T30740                                 

Gene name
JCVI_PEP_1105085702838
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
apc:HIMB59_00014440 (best score: 285.034)
Taxonomy
Alphaproteobacteria [GN:apc]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105085702838
LinkDB All DBs
AA seq 176 aa AA seqDB search
LRRVVVTGLGTINPLGNSVNTSWENLINSKSGISKITKFNVDTYPCKIAGSIEDSLINDE
IVSLREQRKIDRFITLGLIAANEAIVDSGFISDEKSSLRSGVMVGSGIGGLDTIYKNSSV
LDNQGIRKISPFFIPSSLINLLSGHISIKYDLKGPNSSPVTACATGTHAIGDSRPA

KEGG   T30740 (Metagenome): 1105110036479Help
Entry
1105110036479     CDS       T30740                                 

Gene name
JCVI_PEP_1105110036479
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
abe:ARB_06019 (best score: 28.4906)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105110036479
LinkDB All DBs
AA seq 62 aa AA seqDB search
IILDLPISIFSLIEGNIDPTPTPLGYLNAHGLSLISVDVFIILTNSASSLATITMKFGNV
AK

KEGG   T30740 (Metagenome): 1105158900135Help
Entry
1105158900135     CDS       T30740                                 

Gene name
JCVI_PEP_1105158900135
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
mtt:Ftrac_1172 (best score: 266.159)
Taxonomy
Bacteroidetes [GN:mtt]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105158900135
LinkDB All DBs
AA seq 201 aa AA seqDB search
IGFSLKMGSKRVVITGLGAITPIGKNVNEYQNSLFSGLSGCENIVSFDTSKFKTKFACEV
KNYDPLDYFDRKESRKMDIYAQFGMIAAEEAVNDSELNLENIDLSRIGVIWGSGVGGIET
FQNELINFSENDKNPRFNPFFIPKLIPDICPGLIAIKYGFKGPNFATVSACASASNAIID
SYNYIKSGTSDIIITGARSAA

KEGG   T30740 (Metagenome): 1105152999779Help
Entry
1105152999779     CDS       T30740                                 

Gene name
JCVI_PEP_1105152999779
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
gfe:Gferi_01555 (best score: 171.785)
Taxonomy
Firmicutes - Clostridia [GN:gfe]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105152999779
LinkDB All DBs
AA seq 129 aa AA seqDB search
MDKALKDASLSVDDVDYINAHGTSTPANDKNETSAIKTLFGTKAYEVDISSTKSMTGHLL
GGAGAFESMVCILSLQNGVIPPTINLNNKDEECDLNYTPNNAVNKDMNIAMSNSFGFGGH
NGVLVFSKT

KEGG   T30740 (Metagenome): 1105122197587Help
Entry
1105122197587     CDS       T30740                                 

Gene name
JCVI_PEP_1105122197587
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
hel:HELO_2000 (best score: 382.489)
Taxonomy
Gammaproteobacteria - Others [GN:hel]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105122197587
LinkDB All DBs
AA seq 334 aa AA seqDB search
VGNSYILMQLPRRVVVTGMGLISPLGNSVNESWSNCIKGCSGISDNVVDLEDMPIKVGGR
IHDFDPTQYIDSKDIRRLDTFVQYGVSAGIQAIEDAGLDNNVDKDRVGLNIGSGIGGLDS
IERNKDILNKKSFKRVSPFFVPGSIINMTPGYLSIIKGYTGPNLSIVTACASSNHAIGTS
ARLIAYGDADVMVTGGSEMATTPLGVSGFLASRALSKSDDPKTASRPWDKDRDGFVLSDG
AAILILEEYEHAKKRSANIYAEVIGFGMSSDAYHMTAPSEDGIGASLSISRAISDAGISV
NDIDYINAHATSTPLGDLAECNAVKSIFDSPSTH

KEGG   T30740 (Metagenome): 1105122192077Help
Entry
1105122192077     CDS       T30740                                 

Gene name
JCVI_PEP_1105122192077
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
reu:Reut_A2261 (best score: 418.313)
Taxonomy
Betaproteobacteria [GN:reu]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105122192077
LinkDB All DBs
AA seq 307 aa AA seqDB search
MDSGFEISEKNQFRVGAMIGSGIGGLPLIEKTHETLTKKGARRISPFFVPGSIINMISGH
LSIKHGLKGPNLATVTACTSGLHAIGLAYRLIQTGDTDAMLAGGSESTVSPLGIGGFAAA
RALSTRECEPENASRPFDELRDGFVLGEGAGVLFLESYESAVKRNARVYAEIVGFGMSGD
AFHMTAPDSEGAMRCMRTALTDAQINASNVSYINAHGTSTPVGDKNETVAIRHTFNSNIN
DLLISSTKSMTGHLLGGAGGLESVFTVLSVFNDVVPPTINLEFRTRNVTLIIVLMRLEIK
KSNSLLK

KEGG   T30740 (Metagenome): 1105086449283Help
Entry
1105086449283     CDS       T30740                                 

Gene name
JCVI_PEP_1105086449283
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
spoi:IMCC21906_02155 (best score: 161.77)
Taxonomy
Gammaproteobacteria - Others [GN:spoi]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105086449283
LinkDB All DBs
AA seq 132 aa AA seqDB search
KVARLRIKDADLDSSKIDYINAHGTSTPLGDIIEANAIADIFSTSQEQIAVSSTKSMTGH
LLGAAGAIESIFSILSLRDNHLPPTINLDNLDADAPKLNYVANESQEKEINYVLNNSFGF
GGTNASLVFSKI

KEGG   T30740 (Metagenome): 1105133494065Help
Entry
1105133494065     CDS       T30740                                 

Gene name
JCVI_PEP_1105133494065
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
tro:trd_A0447 (best score: 99.7525)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105133494065
LinkDB All DBs
AA seq 107 aa AA seqDB search
LSLLIAFVFFISLMEVSQVNRVVVTGLGVVSPIGLDVESAWKRALAGESGVRGIESFDVS
HFDVKIAAEVKGFDPKTFLDVKKIRKYSRFVQFAIAAAVKPLRRKIS

KEGG   T30740 (Metagenome): 1105075778569Help
Entry
1105075778569     CDS       T30740                                 

Gene name
JCVI_PEP_1105075778569
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 202.986)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105075778569
LinkDB All DBs
AA seq 147 aa AA seqDB search
IMPNFHRVVITGIGAVTPIGNNIDEYLVGLQTGTNGVSDITLFDPEQHPCRFAAEVKNLQ
SENFIEAKESKRWDRFSQFGVIAAKQAFNDSGLEITEANASRIGVIIGSGVGGLLTMESQ
AQILSNKGPKRVSPFTVPMMIPNMALD

KEGG   T30740 (Metagenome): 1105153778095Help
Entry
1105153778095     CDS       T30740                                 

Gene name
JCVI_PEP_1105153778095
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
azl:AZL_016720 (best score: 219.55)
Taxonomy
Alphaproteobacteria [GN:azl]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105153778095
LinkDB All DBs
AA seq 179 aa AA seqDB search
MRRVVVTGIGMCTPLGFGQSHCWKQLISSKSGIRKLVGFEIEDLKSKVGGQLILEGDSSL
YPEQVIEPKDRKKIEPFIEYALIAAKEAIQDSGWNPSNDLESMRTGVMVGSGIGGLDGIR
KSADNLKNSPRRISPFFIPSCLINLASGHISIKYNFKGPNHSVVTACASGAHAIGDSFR

KEGG   T30740 (Metagenome): 1105157825846Help
Entry
1105157825846     CDS       T30740                                 

Gene name
JCVI_PEP_1105157825846
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
tad:TRIADDRAFT_34534 (best score: 369.777)
Taxonomy
Placozoans [GN:tad]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105157825846
LinkDB All DBs
AA seq 266 aa AA seqDB search
VSRWRFRSNHSIVTACSTGSHAIGDASRIISDGDADIMIAGGAEAAICKLGVAGFAAARA
LSTSFNDSPEKASRPWDKDRDGFVMGEGAGILILEEYEHAKKRNANIYAEVIGYGMSGDA
HHITAPEPTGLGALKSMQNALKRACIDPSDLDYINAHGTSTPLGDIIELQAVTKLMNGKL
SELVMSSTKSSIGHLLGAAGAVEAIFSILAMKNKTIPPTINLDNKADEARHINLAPNFSV
EKKISYCLSNSFGFGGTNASLVFKHL

KEGG   T30740 (Metagenome): 1105122088439Help
Entry
1105122088439     CDS       T30740                                 

Gene name
JCVI_PEP_1105122088439
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
tur:AT726_07345 aft:BBF96_04690 (best score: 101.679)
Taxonomy
Firmicutes - Others [GN:tur]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105122088439
LinkDB All DBs
AA seq 106 aa AA seqDB search
IIRIMSKRRVVISGLGTINPLSNNVADSWKKLISGISGIDYITSFDTEDLPVKFAGEVKD
FDANEYMGKQHARKLDRSAHLSIYATEQALRDANFNTEERLGSNVE

KEGG   T30740 (Metagenome): 1105131605527Help
Entry
1105131605527     CDS       T30740                                 

Gene name
JCVI_PEP_1105131605527
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
dae:Dtox_1182 (best score: 162.155)
Taxonomy
Firmicutes - Clostridia [GN:dae]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105131605527
LinkDB All DBs
AA seq 123 aa AA seqDB search
MPESQFKDIDYINAHGTSTPANDKNETLAIKTLFGERAYEVDISSTKSMTGHLLGGAGAF
ESMVCLLSMQNSVIPPTINLISKDEDCDLNYTPNKSINKEVNISMSNSFGFGGHNGVLVF
SKG

KEGG   T30740 (Metagenome): 1105145596753Help
Entry
1105145596753     CDS       T30740                                 

Gene name
JCVI_PEP_1105145596753
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
rbs:RHODOSMS8_00685 (best score: 332.413)
Taxonomy
Alphaproteobacteria [GN:rbs]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105145596753
LinkDB All DBs
AA seq 292 aa AA seqDB search
MKRVVVTGIGLVTPLGCGTDINWKNLISGVSGAKKISKFDASNYKCQVACEVPIDSKIEG
SFVPEEWIDKKELKKLDEFIKYSLAAGEEAFRQSKLMSIEDPVSFRSGCIIGSGMGGLPG
IEETSLSFNNGKKISPFFITGRIINMSAGYLSIKYNLKGPNYSTVSACASSAHAIGESFR
LIQHGQADIMMTGGTEATISPIGIEGFTACKALSTKYNTNPQKASRPFDDERDGFVMGEG
SAILILEEMEHALRRNANILAEMVGYGMSSDAYHYTLPEPSAMERIEQCIMH

KEGG   T30740 (Metagenome): 1105079719419Help
Entry
1105079719419     CDS       T30740                                 

Gene name
JCVI_PEP_1105079719419
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
gfe:Gferi_01555 (best score: 208.764)
Taxonomy
Firmicutes - Clostridia [GN:gfe]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105079719419
LinkDB All DBs
AA seq 161 aa AA seqDB search
QGLRGYVVGYGSTTDAHHITAPAEGGEGAVRAMDKALKDASLSVDDVDYINAHGTSTPAN
DKNETSAIKTLFGTKAYEVDISSTKSMTGHLLGGAGAFESMVCILSLQNGVIPPTINLNN
KDEECDLNYTPKNSVNKDMNIAMSNSFGFGGHNGVLVFSKT

KEGG   T30740 (Metagenome): 1105163523579Help
Entry
1105163523579     CDS       T30740                                 

Gene name
JCVI_PEP_1105163523579
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 162.925)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105163523579
LinkDB All DBs
AA seq 130 aa AA seqDB search
MPNFHRVVITGIGAVTPIGNNIDEYLVGLQTGTNGVSDITLFDPEQHPCKFAAEVKNLQS
ENFIEAKESKRWDRFSQFGVIAAKQAFNDSGLEITEDNASRIGVIIGSGVGGLLTMESQA
QILSHKDLKE

KEGG   T30740 (Metagenome): 1105148596115Help
Entry
1105148596115     CDS       T30740                                 

Gene name
JCVI_PEP_1105148596115
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ttk:TST_1325 (best score: 333.954)
Taxonomy
Aquificae [GN:ttk]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105148596115
LinkDB All DBs
AA seq 296 aa AA seqDB search
LGSLIAGKSGIGSIKSFDATNLSVRIAGELKDFDPQSFFDRKEIRKLDPFTIYHLVSSEE
AILNSGINLDNENRDRIGVIIGTGIGGIQTLENEHGVYVNRGQRRVSPFFVPRFIPNIAS
GNLAIKFGLKGPNHTVISACASGTDAIGCAMRTIQYGDADVMITGGSEASVTGLTISGFA
NIKALSTQNDKPETACRPFDLERDGFVLGEGAAALVLEEEEHALKRNANILAELSGYGAT
DDAFHITQPSEGGMGAIKAMDAALKDAQLSTNEISYINAHGTSTPFNDKTESAAQT

KEGG   T30740 (Metagenome): 1105162594929Help
Entry
1105162594929     CDS       T30740                                 

Gene name
JCVI_PEP_1105162594929
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
gfe:Gferi_01555 (best score: 263.848)
Taxonomy
Firmicutes - Clostridia [GN:gfe]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105162594929
LinkDB All DBs
AA seq 210 aa AA seqDB search
PCVFFSEISQNDIPTEACSPFDKNRDGFVMAEGSTVLILESEESAKNRDAKIYGYVVGYG
STTDAHHITAPAEGGEGAVRAMDKALKDASLSVDDVDYINAHGTSTPANDKNETSAIKTL
FGTKAYEVDISSTKSMTGHLLGGAGAFESMVCILSLQNGVIPPTINLNNKDEECDLNYTP
NNAVNKDMNIAMSNSFGFGGHNGVLVFSKT

KEGG   T30740 (Metagenome): 1105090563495Help
Entry
1105090563495     CDS       T30740                                 

Gene name
JCVI_PEP_1105090563495
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
lep:Lepto7376_4440 ate:Athe_1158 (best score: 338.576)
Taxonomy
Cyanobacteria [GN:lep]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105090563495
LinkDB All DBs
AA seq 334 aa AA seqDB search
IFAAEEAIQDAGFDLSKPLGEDFGIVFGTGIGGIGATEDAVRVYDERGSTRISPLAITQL
MPNSSTGQVAIKYGIQGPSLTITTACAASANAIGEAKRMIEQNIVDKVLVGGTESGTTSM
TIGAFAQIKALSKQNDEPQKACKPFDKNRDGFVMAEGSTVLILESESSAKDRDAKIYGYI
SGYGSSTDAYHITAPSEGGVGALRAMEQAISNADISKEKIDYINAHGTSTPANDLNETLA
IKSLMNDYAYEVNISSTKSMTGHLLGGGGAFEAMASLLSMKNSLIPPTINLNDSDEDCDL
NYTANHSIEKNIDHAMSNSFGFGGHNAVLIFSKQ

KEGG   T30740 (Metagenome): 1105153774753Help
Entry
1105153774753     CDS       T30740                                 

Gene name
JCVI_PEP_1105153774753
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
aft:BBF96_04690 (best score: 256.529)
Taxonomy
Firmicutes - Clostridia [GN:aft]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105153774753
LinkDB All DBs
AA seq 278 aa AA seqDB search
IMSKRRVVVTGLGTINPLANNVENTWNKLLDGVSGINHITSFDTSTLPVTFAGEVKDFDA
NEYMGKQHARKLDRSAHLSIFATEQALKDAKIDTEKRLGTNVGIVFGTGIGGIGATEDAV
RIFDSRGPSRINPLAITQLMPNSSTGQVAIKFGIEGPSLTITTACAASANAVGEAKNLIE
NGIVDMVITGGTESGTTPMTIAAFAQIRALSTKNETPTEACRPFDKNRDGFVMAEGSTVL
VLESEESANKRGVDIYGYVDGYGSTSDAHHIQHPQSNR

KEGG   T30740 (Metagenome): 1105120638473Help
Entry
1105120638473     CDS       T30740                                 

Gene name
JCVI_PEP_1105120638473
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
deq:XM25_04935 (best score: 171.014)
Taxonomy
Alphaproteobacteria [GN:deq]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105120638473
LinkDB All DBs
AA seq 168 aa AA seqDB search
RRRARERTYMQKLLDMACQVMLIILHAPEPTGLGALKSMQNAIKRASIDPSDLDYINAHG
TSTPLGDIIELQAVTKLMNGKLGKLVMSSTKSSIGHLLGAAGAVEAVFSILAMKNKTIPP
TINLENEADEARHFNLAPNFSVEKKISYCLSKSFGFGGTNASLVFKHL

KEGG   T30740 (Metagenome): 1105121669797Help
Entry
1105121669797     CDS       T30740                                 

Gene name
JCVI_PEP_1105121669797
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
smg:SMGWSS_015 (best score: 115.546)
Taxonomy
Bacteroidetes [GN:smg]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105121669797
LinkDB All DBs
AA seq 89 aa AA seqDB search
MKNKRVVVTGMGAITPIGNNISEYWHGLINSISGADSIKRFNVENFKTKFACQIKNYLSD
SFFEKKESRKLDLFSQYGLMPQRSITNRH

KEGG   T30740 (Metagenome): 1105132754637Help
Entry
1105132754637     CDS       T30740                                 

Gene name
JCVI_PEP_1105132754637
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
acii:C4901_08845 (best score: 172.94)
Taxonomy
Gammaproteobacteria - Others [GN:acii]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105132754637
LinkDB All DBs
AA seq 197 aa AA seqDB search
MTKQRVVVTGLGTINPLGNNVIDTWNNLTSGISGIDHITLFDASDLPVTFAGEVKNFDAN
EYMGKQNARKLDRSGHLSIFAAEEAIQDAGFDLSKPLGEDFGIVFGTGIGGIGATEDAVR
VYDERGSTRISPLAITQLMPNSSTGQVAIKYGIQGPSLTITTACAASANAIGEAKRMIEQ
NIVDKVLVGGTESGTTS

KEGG   T30740 (Metagenome): 1105121670419Help
Entry
1105121670419     CDS       T30740                                 

Gene name
JCVI_PEP_1105121670419
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ate:Athe_1158 (best score: 318.161)
Taxonomy
Firmicutes - Clostridia [GN:ate]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105121670419
LinkDB All DBs
AA seq 303 aa AA seqDB search
MSDKRVVVTGMGVVSPIGNNLDHFWNNLKKGTNGINDISLFDTTNFDVKIAGESNIDLKS
FFDRKELNKLDRFSAFALIAAEQAINQSNILDCKTSPSRIGVIVGSGIGGIGTFEAQHKK
LLKNPRFVSPFFIPSMISDIAAGQISIKYGFKGINYSVASACATSNHAFGDAYKMIQSGM
ADVIVSGGSEAAITEMSIAGFSNMKALSKNPDRKSASRPFDKNRDGFVMGEGAGILVLES
YNHAKSRGAKILGEIVGYGATADAYHITSPDLEGKGGEMAMLNAISDADLDLTDITYINA
LKP

KEGG   T30740 (Metagenome): 1105121669813Help
Entry
1105121669813     CDS       T30740                                 

Gene name
JCVI_PEP_1105121669813
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
alo:CRK58246 (best score: 69.3218)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105121669813
LinkDB All DBs
AA seq 211 aa AA seqDB search
IRTVMGSSWPREPPFWSSRPGNSPRRAAQRSLAKSSALPPPPMPTTSRPRHQVAWVPSRA
CSWPWTTLASRPIRSDTSTRTAPRPTRTTLPKPRPSPRCSAPTTRGPLVTSTKGITGHAL
GAASALEAVAVLLAMQHGKVPPTAGLIERDPELPRSPSVEGGPRRLGARAITVDSFCFSG
QTAPWFSARPDSHRTLLKRSASSGAGSRLLG

KEGG   T30740 (Metagenome): 1105121669809Help
Entry
1105121669809     CDS       T30740                                 

Gene name
JCVI_PEP_1105121669809
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
aym:YM304_21300 (best score: 327.02)
Taxonomy
Actinobacteria [GN:aym]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105121669809
LinkDB All DBs
AA seq 301 aa AA seqDB search
LLSPAPNGFRQIEDWDPSPYFDNPKEARRSDRVSQFTLAAAAEALEQAGEISDDPARRGT
FVGTGVGGIGTLEEQIEVRLSKGERRVSPFLVPMMMANAPAATISMRYGWQGPCENTVTA
CAAGTHAIGNAARMVANGRCDVVMAGGAEAPFTPTAVAGFGNMTALSNSGDSRPFDTNRD
GFVMAEGAAILVLEAWELAEARSATILGEVLGSASTADAHHITAPSPGGVGAVTCMQLAM
DDAGITPDQVRHINAHGTSTDKNDAAEAEAVAKVFGTDDSGPVGHLDQGHHRPCARRRQC
T

KEGG   T30740 (Metagenome): 1105081306429Help
Entry
1105081306429     CDS       T30740                                 

Gene name
JCVI_PEP_1105081306429
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ana:alr3343 ava:Ava_3646 (best score: 92.4337)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105081306429
LinkDB All DBs
AA seq 94 aa AA seqDB search
IMTDNKKRVVITGMGVISCAGNTVKEFWDSLLNGKSGIDYLKQLNTENYSCKIGGEIKNF
DPLNYMDKKESKRLATKLSVCCSCNNGGYICRRM

KEGG   T30740 (Metagenome): 1105085704774Help
Entry
1105085704774     CDS       T30740                                 

Gene name
JCVI_PEP_1105085704774
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 199.519)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105085704774
LinkDB All DBs
AA seq 126 aa AA seqDB search
IEDACLSLEKVDYINAHGTSTSANDKNETSAIKSIFKDRSYLIPVSSTKSMTGHLLGGSG
GIEAVACILSLTHNFIPPTINYVNQDPECDLDYVPNNAREAKVGVALSNSFGFGGHNVCL
AFSKMN

KEGG   T30740 (Metagenome): 1105098622587Help
Entry
1105098622587     CDS       T30740                                 

Gene name
JCVI_PEP_1105098622587
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 502.671)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105098622587
LinkDB All DBs
AA seq 314 aa AA seqDB search
IKNGVIIVWCGGLLTMESQAQILSHKGLKRVSSFTVPMMIPNMATGLAAIALGAKGPSSS
VSTACAAGSNAIGDSFRLLQLGKADAMICGGAEASITPLGVAGFASAKALSSRNDSPQTA
SRPFDAERDGFVIGEGSGILVLETLENAQKRNARIYAELVGYGTTCDAHHITAPSPGGVG
GAEAIKLAIKDACLSLEKVDYINAHGTSTSANDKNETSAIKSIFKDRSYLIPVSSTKSMT
GHLLGGSGGIEAVACILSLTHNFIPPTINYVNPDPECDLDYVPNNAREAQIRVALSNSFG
FGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105093906131Help
Entry
1105093906131     CDS       T30740                                 

Gene name
JCVI_PEP_1105093906131
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
arb:A9P82_11530 (best score: 133.65)
Taxonomy
Bacteroidetes [GN:arb]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105093906131
LinkDB All DBs
AA seq 106 aa AA seqDB search
MKSRRVVVTGMGALTPIGNSINEFWQNLVDGKSGADKITLFDADKFKTKFACEVKGFQAE
DYLDRKEARRLDRFCQLALVVADQALTDSKLLSSNSIKIELGTPAY

KEGG   T30740 (Metagenome): 1105132325017Help
Entry
1105132325017     CDS       T30740                                 

Gene name
JCVI_PEP_1105132325017
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
coc:Coch_1320 (best score: 119.398)
Taxonomy
Bacteroidetes [GN:coc]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105132325017
LinkDB All DBs
AA seq 113 aa AA seqDB search
MHKKVVVTGVGALAPNGNSAEQFWLAIESGTSGIAPITYFDASNHRVSIARELKDFNPED
TLDSKEIRKLDPFSTFALVCSNEAIPSANLDLESIDLDRAGVVIGSELEEFKR

KEGG   T30740 (Metagenome): 1105130495397Help
Entry
1105130495397     CDS       T30740                                 

Gene name
JCVI_PEP_1105130495397
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
cthi:THC_0263 (best score: 256.144)
Taxonomy
Thermodesulfobacteria [GN:cthi]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105130495397
LinkDB All DBs
AA seq 275 aa AA seqDB search
MTKQRVVVTGLGTINPLGNNVIDTWNNLTSGVSGIDHITLFDASDLPVTFAGEVKNFDAN
EYMGKQNARKLDRSGHLSIFAAEEAIQDAGFDLSKPLGEDFGIVFGTGIGGIGATEDAVR
VYDERGSTRISPLAITQLMPNSSTGQVAIKYGIQGPSLTITTACAASANAIGEAKRMIEQ
NIVDKVLVGGTESGTTSMTIGAFAQIKALSKQNDEPQKACKPFDKNRDGFVMAEGSTVLI
LESESSAKDRDAKIYGYISGYGSSTDAYHITVLQT

KEGG   T30740 (Metagenome): 1105130691183Help
Entry
1105130691183     CDS       T30740                                 

Gene name
JCVI_PEP_1105130691183
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
lch:Lcho_0607 (best score: 89.7373)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105130691183
LinkDB All DBs
AA seq 91 aa AA seqDB search
MTKQRVVVTGLGTINPLGNNVIDTWNNLTSGVSGIDHITLFDASDLPVTFAGEVKNFDAN
EYMGKQNARKLGSVWPFIYFCCRRGNSRCWI

KEGG   T30740 (Metagenome): 1105132588897Help
Entry
1105132588897     CDS       T30740                                 

Gene name
JCVI_PEP_1105132588897
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
mro:MROS_2456 (best score: 131.724)
Taxonomy
Chlorobi [GN:mro]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105132588897
LinkDB All DBs
AA seq 106 aa AA seqDB search
ITPANDLNETLAIKSLMNDYAYEVNISSTKSMTGHLLGGGGAFEAMASLLSMKNNQIPPT
INLNDLDEDCDLNYTANHSVDKNIDHVMSNSFGFGGHNAVLIFSKE

KEGG   T30740 (Metagenome): 1105104841065Help
Entry
1105104841065     CDS       T30740                                 

Gene name
JCVI_PEP_1105104841065
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pig:EGT29_15850 (best score: 129.413)
Taxonomy
Betaproteobacteria [GN:pig]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105104841065
LinkDB All DBs
AA seq 123 aa AA seqDB search
IKPDEMTESKRVVVTGLGCVSPLGNTVAETWEKGSKGQSGIDRIEKFDPSEMRCQIAGEV
RNFELPDLVPPKEAKKMDLFIHYAIAATQEALQDAALEITEPLEEEVGISMGVGIGGLAA
AAN

KEGG   T30740 (Metagenome): 1105109157949Help
Entry
1105109157949     CDS       T30740                                 

Gene name
JCVI_PEP_1105109157949
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
cac:CA_C3573 (best score: 304.293)
Taxonomy
Firmicutes - Clostridia [GN:cac]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105109157949
LinkDB All DBs
AA seq 292 aa AA seqDB search
IMIQRVVVTGLGTVNPLSKNVSGFWDALINKKNGINKITHFDSSNFKTKLSAEVNIDLNN
YFNKKELNKIDRFTAFALIASNEAIIDAKIDKTINKNRVGVIIGSGIGGINTLEKEHKKS
LKSPRRVSPYFVPSMISDIAAGHISIKYGFRGPNFSVVSACASSNHAIGMAFKSIKFNES
DIIITGGSEAGITPLSIAGFMNMKALSTEQNRNKASIPFDLNRNGFVMGEGSGILVLESL
KSALKRNAKIYAEISGYGSTADAYHLTSPAPNGTVQISYEIALSEASLNLRY

KEGG   T30740 (Metagenome): 1105153000391Help
Entry
1105153000391     CDS       T30740                                 

Gene name
JCVI_PEP_1105153000391
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
hml:HmaOT1_09965 (best score: 436.802)
Taxonomy
Alphaproteobacteria [GN:hml]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105153000391
LinkDB All DBs
AA seq 278 aa AA seqDB search
IPGALINLISGQVSIRHGFKGPNHAVSTACSTGAHSIGDAARLIINGDADVMLAGGSESP
ITEIGIAGFNACKALSTKFSNNPKTASRPYDKDRDGFVMGEGAGVLVLEEYQHALARNAN
IYCELVGYGLSGDAHHITAPSEDGDGGYRSMLAALNSSNLHYKDIDYINAHGTSTMADII
ELGAVEKLLAEHVPNVTMSSTKSSIGHLLGAAGAVEAIFCILSIRDQIAPPTINLDNIAK
ETKLDLAPNISVKKEINIALSNSFGFGGTNASLIFKKI

KEGG   T30740 (Metagenome): 1105075776129Help
Entry
1105075776129     CDS       T30740                                 

Gene name
JCVI_PEP_1105075776129
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
rbs:RHODOSMS8_00685 (best score: 139.813)
Taxonomy
Alphaproteobacteria [GN:rbs]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105075776129
LinkDB All DBs
AA seq 132 aa AA seqDB search
MKRVVVTGIGLVTPLGCGTDINWKNLISGVSGAKKISKFDANNYKCQVACEVPTDGKTAG
SFVAEDWIDKKELKKLDEFLKYSLAAGEEAFQQSKLMNIEDPDSFRSGCIIGSGMGGLPG
IEETSCLNRRPF

KEGG   T30740 (Metagenome): 1105081306427Help
Entry
1105081306427     CDS       T30740                                 

Gene name
JCVI_PEP_1105081306427
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
cau:Caur_1931 (best score: 78.5666)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105081306427
LinkDB All DBs
AA seq 103 aa AA seqDB search
LEVVPEAQSLKQKKKLFKCMTKREILLVSIYVPKMLPNMAASSVSRIFNLEGYSNAVSTS
SAAGTQAIGEAYEVILRGDADIMIAGGAEAPFCETTSKAEFCK

KEGG   T30740 (Metagenome): 1105148018455Help
Entry
1105148018455     CDS       T30740                                 

Gene name
JCVI_PEP_1105148018455
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
kci:CKCE_0156 mmn:midi_01096 (best score: 29.261)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105148018455
LinkDB All DBs
AA seq 72 aa AA seqDB search
IPMIQHPQVAHGTKIVMVCIVRCSSILVLEEYEHAKKDQRIFMQKLLVWHEFGCLSYDCT
LRGRNWCLIINF

KEGG   T30740 (Metagenome): 1105075555401Help
Entry
1105075555401     CDS       T30740                                 

Gene name
JCVI_PEP_1105075555401
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
psom:113310767 (best score: 28.4906)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105075555401
LinkDB All DBs
AA seq 69 aa AA seqDB search
ILPVDVFGSSQKSIFFGILNPARVSLQKSINSFSFVSLSATFSINAHGTSPHFSSGFATT
ATMKQLQAV

KEGG   T30740 (Metagenome): 1105085821092Help
Entry
1105085821092     CDS       T30740                                 

Gene name
JCVI_PEP_1105085821092
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
hml:HmaOT1_09965 (best score: 477.633)
Taxonomy
Alphaproteobacteria [GN:hml]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105085821092
LinkDB All DBs
AA seq 316 aa AA seqDB search
IKFGDGTNDTFNPDDWMEPKDQRKVDYFILYGVAAAEQAIKDSGWMPTTDNGKNRTGVII
GSGIGGLGSIAQTAIQINEKGPRRVSPFFIPGALINLISGQVSIRYGFKGPNHAVSTACS
TGAHSIGDATRLIINGDADVMIAGGSESPITQIGIAGFNACRALSTKFSDDPISASRPYD
KDRDGFVMGEGAGVLVLEDYEHARARNAKIYCEIVGYGLSGDAYHITAPSEDGDGGYRSM
VAALKSSGLSYKNIDYINAHGTSTMADTIELGAVEKLLGDYAPNVTMSSTKSSIGHLLEL
RVLLKLYFAFYQLEIK

KEGG   T30740 (Metagenome): 1105117915163Help
Entry
1105117915163     CDS       T30740                                 

Gene name
JCVI_PEP_1105117915163
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ttm:Tthe_1491 (best score: 159.844)
Taxonomy
Firmicutes - Clostridia [GN:ttm]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105117915163
LinkDB All DBs
AA seq 117 aa AA seqDB search
IDYINAHGTSTYYNDLHETQAIKNLFKNHAYKLSINSTKSNMGHLLGAAGSVEAIATIKS
IINSYITPTINYKTEDPECDLDYTTKSETKKNINHAISNNFGFGGHNASIVISKFIE

KEGG   T30740 (Metagenome): 1105152453877Help
Entry
1105152453877     CDS       T30740                                 

Gene name
JCVI_PEP_1105152453877
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 432.565)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105152453877
LinkDB All DBs
AA seq 265 aa AA seqDB search
LYALGARASSSVSTACAAGSNAIGDSFRLLQLGKADAMICGGAEASITPLGVAGFASAKA
LSFRNDSPQTASRPFDAERDGFVIGEGSGILVLETLENAQKRNARIYAEITGYGTTCDAH
HITAPSPGGVGGAEAIKLAIEDASLSLEKVDYINAHGTSTSANDKNETSAIKSIFRDRSY
LIPVSSTKSMTGHLLGGSGGIEAVACILSLTHNFIPPTINYVNPDPECDLDYVPNNAREA
QVRVALSNSFGFGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105086449881Help
Entry
1105086449881     CDS       T30740                                 

Gene name
JCVI_PEP_1105086449881
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
mro:MROS_2456 (best score: 171.014)
Taxonomy
Chlorobi [GN:mro]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105086449881
LinkDB All DBs
AA seq 136 aa AA seqDB search
KLSAALEHGQAISNADISKEKIDYINAHGTSTPANDLNETLAIKSLMNDYAYEVNISSTK
SMTGHLLGGGGAFEAMASLLSMKNSLIPPTINLNDSDEDCDLNYTANHSIEKNIDHAMSN
SFGFGGHNAVLIFSKQ

KEGG   T30740 (Metagenome): 1105142442245Help
Entry
1105142442245     CDS       T30740                                 

Gene name
JCVI_PEP_1105142442245
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 380.948)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105142442245
LinkDB All DBs
AA seq 245 aa AA seqDB search
IMPNFHRVVITGIGAVTPIGNNIDEYLVGLQTGTNGVSDITLFDPEQHPCRFAAEVKNLQ
SENFIEAKESKRWDRFSQFGVIAAKQAFNDSGLEITEANASRIGVIIGSGVGGLLTMESQ
AQILSNKGPKRVSPFTVPMMIPNMATGLAAIALGAKGPSSSVSTACAAGSNAIGDSFRLL
QLGKADAMICGGAEASITPLGVAGFASAKALSFRNDSPQTASRPFDAERDGFVIGEGSGI
LVLET

KEGG   T30740 (Metagenome): 1105148012527Help
Entry
1105148012527     CDS       T30740                                 

Gene name
JCVI_PEP_1105148012527
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
aft:BBF96_04690 (best score: 212.231)
Taxonomy
Firmicutes - Clostridia [GN:aft]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105148012527
LinkDB All DBs
AA seq 161 aa AA seqDB search
IIGEIIGYGITNDAFHITQPDNESTGASNAISMALNDAEIDTSEVGYINAHGTSTYFNDM
LETQAIKKVFGKDAKNVSISSTKSMTGHLLGAAGAIEAITCINSLNNGIIPPTINYNNPD
PECNLDYTPNESFKKDINISMSNSFGFGGHNSVVIFKKFSS

KEGG   T30740 (Metagenome): 1105148018449Help
Entry
1105148018449     CDS       T30740                                 

Gene name
JCVI_PEP_1105148018449
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
plg:NCTC10937_01711 (best score: 198.364)
Taxonomy
Betaproteobacteria [GN:plg]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105148018449
LinkDB All DBs
AA seq 165 aa AA seqDB search
MNMLKKISEYLCRSYWFGMSSDAYHMTAPSEDGTGASLSISRAISDAGISTNDIDYINAH
ATSTPLGDLAECNAVKSIFDSPPPISSTKSMTGHTLGAAGAVESIFSILSIVNNISPPTI
NLNNPDEGCDLDFIPKEARDMKIDVSLNNSFGFGGTNSTLIFKSA

KEGG   T30740 (Metagenome): 1105149135077Help
Entry
1105149135077     CDS       T30740                                 

Gene name
JCVI_PEP_1105149135077
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 436.032)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105149135077
LinkDB All DBs
AA seq 275 aa AA seqDB search
IEAKESKRWDRFSQFGVIAAKQAFNDSGLEITEANASRIGVIIGSGVGGLLTMESQAQIL
SHKGPKRVSPFTVPMMIPNMATGLAAIALGAKGPSSSVSTACAAGSNAIGDSFRLLQLGK
ADAMICGGAEASITPLGVAGFASAKALSSRNESPQTASRPFDAERDGFVIGEGSGILVLE
TLENAQKRNARIYAEIVGYGTTCDAHHITAPSPGGIGGAEAIKLAIEDACLSLETVDYIN
AHGTSTSANDKNETSAIKSIFKDRSYLIPVSSTKS

KEGG   T30740 (Metagenome): 1105157828894Help
Entry
1105157828894     CDS       T30740                                 

Gene name
JCVI_PEP_1105157828894
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 87.0409)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105157828894
LinkDB All DBs
AA seq 75 aa AA seqDB search
IEAVACILSLTHNFIPPTINYVNPDPECDLDYVPNNAREAQIRVALSNSFGIWWSHVALL
LANELETLFCILLLI

KEGG   T30740 (Metagenome): 1105123910427Help
Entry
1105123910427     CDS       T30740                                 

Gene name
JCVI_PEP_1105123910427
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
phyp:113533133 (best score: 29.261)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105123910427
LinkDB All DBs
AA seq 74 aa AA seqDB search
TVLQSGASITAIEFFLASFDTCKALSTSTVEQSTSIVLEVHKGISSSYTFLKTFPSGNIE
IIILHSSAIFGIES

KEGG   T30740 (Metagenome): 1105095906117Help
Entry
1105095906117     CDS       T30740                                 

Gene name
JCVI_PEP_1105095906117
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ren:EF513_00965 (best score: 284.263)
Taxonomy
Alphaproteobacteria [GN:ren]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105095906117
LinkDB All DBs
AA seq 203 aa AA seqDB search
FNDDPERASRPWDKNRDGFVLSEGSGIIVLEELEHAKKRSANIHAEIIGYGLSGDAYHPT
APASDGDGGFRAMKMALKNAHLDSENIDYINAHGTSTPLGDEIEFNSVKKLFSNNTSNLL
MSSTKSSTGHLLGASGAVEAIFSILSIKNSIAPPTLNLEELSDGCQGINLVPKESVEKEI
NHVLSNSFGFGGTNVSLIFKKIN

KEGG   T30740 (Metagenome): 1105157894816Help
Entry
1105157894816     CDS       T30740                                 

Gene name
JCVI_PEP_1105157894816
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
salh:HMF8227_01548 (best score: 160.614)
Taxonomy
Gammaproteobacteria - Others [GN:salh]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105157894816
LinkDB All DBs
AA seq 161 aa AA seqDB search
IAIPNSSQKTSMSDRRVVITGLGLLSPVGNNVSDSWKNILSGTSGAQTIDRFDVSKFETQ
FAATVDIDLSDYLDKKEIRRTDPFIQYGLVAADECLLDSSIDLNNVDKARFGVSIGSGIG
GLGTIEDNKTKLSDSGPKKISPFFVPGAISNMVSGYASSQP

KEGG   T30740 (Metagenome): 1105152970185Help
Entry
1105152970185     CDS       T30740                                 

Gene name
JCVI_PEP_1105152970185
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
paby:Ga0080574_TMP4267 (best score: 295.049)
Taxonomy
Alphaproteobacteria [GN:paby]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105152970185
LinkDB All DBs
AA seq 214 aa AA seqDB search
WRGWSMLAGFVTKFSEEPSIASRPYDTDRDGFVMGEGAGILVLEELEHAKKRGAKIYCEV
LGYGLTGDAHHITAPPPDGDGGKRSMVAALESSRSNISDIDYINAHGTSTMADTIELGAV
ESLAMNYSSNISMSSTKSSIGHLLGAAGSVEAIFSILSIRDQIVPPTINLENPEIETKID
LVPKQARERKVVRALSNSFGFGGTNASLVLGKLN

KEGG   T30740 (Metagenome): 1105149644559Help
Entry
1105149644559     CDS       T30740                                 

Gene name
JCVI_PEP_1105149644559
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
hel:HELO_2000 (best score: 338.961)
Taxonomy
Gammaproteobacteria - Others [GN:hel]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105149644559
LinkDB All DBs
AA seq 236 aa AA seqDB search
RGGSGDADVVIAGGAEKASTQLGIAGFSAARALSTRNDDPQAASRPWDKDRDGFVLADGA
ATMVLEDYESAKARGANIICELVGFGMSDDAHHMTAPAEDGRGAHGAMANALKDAGLSAD
QVDYVNAHGTSTPLGDVAESQAVESLMGAHASKVAVSSTKSMTGHALGAAGALEACFSVL
AIRDQVLPPTINLDSIDEGCRLDYVPNTAREATIDVALSNSFGFGGTNGTLVFKRV

KEGG   T30740 (Metagenome): 1105150618765Help
Entry
1105150618765     CDS       T30740                                 

Gene name
JCVI_PEP_1105150618765
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 447.973)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105150618765
LinkDB All DBs
AA seq 297 aa AA seqDB search
IEAKESKRWDRFSQFGVIAAKQAFNDSGLEITEDNASRIGVIIGSGVGGLLTMESQAQIL
SHKGPRRVSPFTVPMMIPNMATGLAAIALGAKGPSSSVSTACAAGSNAIGDSFRLLQLGK
ADAMICGGAEASITPLGVAGFASAKALSSRNDSPQTASRPFDAERDGFVIGEGSGILVLE
TLENAEKRNARIYAEIVGYGTTCDAHHITAPSPGGVGGAEAIKLAIEDACLSLEKVDYIN
AHGTSTSANDKNETSAIKSIFKDRSYLIPVSSTKSMTGHLLEAQRYRSCSLYTFFDT

KEGG   T30740 (Metagenome): 1105092230587Help
Entry
1105092230587     CDS       T30740                                 

Gene name
JCVI_PEP_1105092230587
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 147.132)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105092230587
LinkDB All DBs
AA seq 93 aa AA seqDB search
IYFKDRSYLIPVSSTKSMTGHLLGGSGGIEAVACILSLTHNFIPPTINYVNRDPECDLDY
VPNNAREAQVGVALSNSFGFGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105083356632Help
Entry
1105083356632     CDS       T30740                                 

Gene name
JCVI_PEP_1105083356632
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
reu:Reut_A2261 (best score: 222.246)
Taxonomy
Betaproteobacteria [GN:reu]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105083356632
LinkDB All DBs
AA seq 173 aa AA seqDB search
APGVGAGLKNARVYAEIVGFGMSGDAFHMTAPDSEGATRCMRAALTDAKLNASDVAYINA
HGTSTPVGDKNETIAINNTFISSTSDLLISSTKSMTGHLLGGAGGLESVFTVLSVFNDVV
PPTINLEFPDEECNLDYCANEARDKKINFALKNNFGFGGTNGSLIFKKIGVDL

KEGG   T30740 (Metagenome): 1105164086017Help
Entry
1105164086017     CDS       T30740                                 

Gene name
JCVI_PEP_1105164086017
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 408.297)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105164086017
LinkDB All DBs
AA seq 269 aa AA seqDB search
WIGCNCFGCKGTKFLCFHRLRCSSNAIGDSFRLLQLGKADAMICGGAEASITPLGVAGFA
SAKALSSRNESPQTASRPFDAERDGFVIGEGSGILVLETLENAQKRDARIYAEIVGYGTT
CDAHHITAPSPGGIGGSEAIKLAIEDASLSLEKIDYINAHGTSTSANDKNETSAIKSIFK
DRSYLIPVSSTKSMTGHLLGGSGGIEAVACILSLTHNFIPPTINYVNPDPECDLDYVPNN
AREAQVGVALSNSFGFGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105079723401Help
Entry
1105079723401     CDS       T30740                                 

Gene name
JCVI_PEP_1105079723401
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
acii:C4901_08845 (best score: 164.466)
Taxonomy
Gammaproteobacteria - Others [GN:acii]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105079723401
LinkDB All DBs
AA seq 195 aa AA seqDB search
MTKQRVVVTGLGTINPLGNNVIDTWNNLTSGVSGIDHITLFDASDLPVTFAGEVKNFDAN
EYMGKQNARKLDRSGHLSIFAAEEAIQDAGFDLSKPLGEDFGIVFGTGIGGIGATEDAVR
VYDERGSTRISPLAITQLMPNSSTGQVAIKYGIQGPSLTITTACAASANAIGEAKRMIEQ
NIVDKVLWRTDCQRY

KEGG   T30740 (Metagenome): 1105145914873Help
Entry
1105145914873     CDS       T30740                                 

Gene name
JCVI_PEP_1105145914873
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 201.445)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105145914873
LinkDB All DBs
AA seq 134 aa AA seqDB search
LALQLSISIEDACLSLEKVDYINAHGTSTSANDKNETSAIKSIFRDRSYLIPVSSTKSMT
GHLLGGSGGIEAVACILSLTHNFIPPTINYVNPDPECDLDYVPNNAREAQVGVALSNSFG
FGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105131607737Help
Entry
1105131607737     CDS       T30740                                 

Gene name
JCVI_PEP_1105131607737
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 494.967)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105131607737
LinkDB All DBs
AA seq 306 aa AA seqDB search
LVWRLATMESQAQILSHKGPKRVSPFTVPMMIPNMATGLAAIALGAKGPSSSVSTACAAG
SNAIGDSFRLLQLGKADAMICGGAEASITPLGVAGFASAKALSFRNDSPQTASRPFDAER
DGFVIGEGSGIIVLETLENAQKRNARIYAEIIGYGTTCDAHHITAPSPGGVGGAAAIKLA
IDDACLSLEKVDYINAHGTSTSANDKNETSAIKSIFRDRSYLIPVSSTKSMTGHLLGGSG
GIEAVACILSLTHNFIPPTINYVNPDPDCDLDYVPNNARDAQVGVALSNSFGFGGHNVCL
AFSKMN

KEGG   T30740 (Metagenome): 1105090566855Help
Entry
1105090566855     CDS       T30740                                 

Gene name
JCVI_PEP_1105090566855
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ttf:THTE_3527 (best score: 476.478)
Taxonomy
Planctomycetes [GN:ttf]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105090566855
LinkDB All DBs
AA seq 341 aa AA seqDB search
FLMGAGRRRVVITGMGCVTPLGVKVDQLWENLKASKSAVGLTTVFDASKFPTKISAEVRD
WCVTDEGEDAKQWEFCGRHTKFAAGAARQAMRDAGLEKGLPSNPTKLGIYLGSGEGQQDF
DAFTNMMMAAISGDTLDVARFTKLGLETLHPLTEVEQEPNMPAAHLAGMFDAQGPNLNCL
TACAASSQAIGEATELVRRGDAEVMLSGGTHSMIHPFGVTGFNLLTALSTRNDEPTRASR
PFDNERDGFVLGEGAAMVVLEELEHAKKRGAHIHGEILGYGSTADAYRITDTHPEGRGAT
SCIRMALADAGLGIHDIHYVNAHGTSTDVNDKVETACTPGR

KEGG   T30740 (Metagenome): 1105120284613Help
Entry
1105120284613     CDS       T30740                                 

Gene name
JCVI_PEP_1105120284613
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ttm:Tthe_1491 (best score: 184.882)
Taxonomy
Firmicutes - Clostridia [GN:ttm]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105120284613
LinkDB All DBs
AA seq 148 aa AA seqDB search
ISSNLPPLQMGTGANQAMKIALSEASLKPEDIDYINAHGTSTYYNDLHETQAIKNLFKNH
AYKLSINSTKSNMGHLLGAAGSVEAIATIKSIINSYITPTINYKTEDPECDLDYTTKSET
KKNINHAISNNFGFGGHNASIVISKFIE

KEGG   T30740 (Metagenome): 1105121668241Help
Entry
1105121668241     CDS       T30740                                 

Gene name
JCVI_PEP_1105121668241
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 301.212)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105121668241
LinkDB All DBs
AA seq 210 aa AA seqDB search
MPNFHRVVVTGIGAVTPIGNNIDEYLLSLQKGINGVKGITLFDPINHPCKFAAEVKNLHT
ENVLEAKESKRWDRFSQFGVIAAKQAFSDSGIEITEDNASRIGVIIGSGVGGLLTMESQA
QILSHKGPKRVSPFTVPMMIPNMATGLAAIALGAKGPSSSVSTACAAGSNAIGDSFRLLQ
LGKADAMICGGAEASITPLGVAGLPSPNGS

KEGG   T30740 (Metagenome): 1105112089035Help
Entry
1105112089035     CDS       T30740                                 

Gene name
JCVI_PEP_1105112089035
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
cthi:THC_0263 (best score: 243.817)
Taxonomy
Thermodesulfobacteria [GN:cthi]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105112089035
LinkDB All DBs
AA seq 270 aa AA seqDB search
IMSKRRVVITGLGTINPLGNNVSDSWEKLINGISGIDNITSFDTGDLPVTFAGEVKNFDA
NEYMGKQHARKLDRSGHLSIYAAEQALLDAGFNPEERMGSNCGIVFGTGIGGIGATEDAV
RVYDERGASRINPLAITQLMPNSSTGQVAIKFGIEGPSLTITTACAASANAVGEAKNMIE
NGIVDIVVAGGTESGTTPMTIGAFAQIRALSTKNDTPAEACSPFDKNRDGFVMAEGSTVL
ILESEESAKSRDAKIYGYVVGTDLHYKPAP

KEGG   T30740 (Metagenome): 1105117051127Help
Entry
1105117051127     CDS       T30740                                 

Gene name
JCVI_PEP_1105117051127
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
psom:113310767 (best score: 32.7278)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105117051127
LinkDB All DBs
AA seq 101 aa AA seqDB search
ILPVDVFGSSQKSIFFGILNPARVSLQKSINSFSFVSLSATFSINAHGTSPHFSSGFATT
ATIETAGCLESVFSISIEEIFSPPEIIISLDLSLTLMYPSG

KEGG   T30740 (Metagenome): 1105143413237Help
Entry
1105143413237     CDS       T30740                                 

Gene name
JCVI_PEP_1105143413237
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
odi:ODI_R1428 (best score: 325.094)
Taxonomy
Betaproteobacteria [GN:odi]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105143413237
LinkDB All DBs
AA seq 334 aa AA seqDB search
MKMTESKRVVVTGLGCVSPLGNTVAETWEKGSQGQSGIDRIEKFDPSEMRCQIAGEVRNF
ELPDLVPPKEAKKMDLFIHYAIAATQEALQDAALEITEPLEEEVGISMGVGIGGLGCIEK
YTKILLEQGPKRVSPFFIPMTLSNLAPGQVSMLFRARNYSACSVSACASSNHAIGTAMRH
IERGDAKVMISGGAESSVTPLGIAGFAAMHALSTRNEEPQKASRPYDTGRDGFVMGEGAG
MLILEEYEFAKQRGARIYCELVGYGASSDAFHITAPSTEGPAHAVKIAVKTRGLIQKRSI
TSYSWYFHPGRDIHELKALKLALGDGNGQPHSRS

KEGG   T30740 (Metagenome): 1105108961775Help
Entry
1105108961775     CDS       T30740                                 

Gene name
JCVI_PEP_1105108961775
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
cyq:Q91_1368 (best score: 91.6633)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105108961775
LinkDB All DBs
AA seq 71 aa AA seqDB search
IMSKRRVVITGLGTINPLGNNVSDSWEKLINGISGIDNITSFDTGDLPVTFAGEVKNFDA
NEYMGKQHARK

KEGG   T30740 (Metagenome): 1105115196611Help
Entry
1105115196611     CDS       T30740                                 

Gene name
JCVI_PEP_1105115196611
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
ise:JBKA6_0115 (best score: 150.599)
Taxonomy
Bacteroidetes [GN:ise]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105115196611
LinkDB All DBs
AA seq 98 aa AA seqDB search
LGAVFKDHLYSMNINSTKSMTGHLLGAAGAIEAISCILSINNNLVPPTINHFNKDPEIDP
KINFTFNKSQSRDVKVAMSNTFGFGGHNACVMIKEFEE

KEGG   T30740 (Metagenome): 1105086226013Help
Entry
1105086226013     CDS       T30740                                 

Gene name
JCVI_PEP_1105086226013
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
rmb:K529_008115 (best score: 523.472)
Taxonomy
Alphaproteobacteria [GN:rmb]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105086226013
LinkDB All DBs
AA seq 348 aa AA seqDB search
RLAASDYSTSYACEIPFGDDSEEKFNPDEWMNLKDRRKVDDFILYGICAADQAVKDAGWI
PDREEDLLRTGVMIGSGIGGLQSIGDTANLIKDKGPRRVSPFFIPGALINLISGQVSIRY
GFKGPNHAVVTACSTGAHAIGDAARFIKSGEADVMIAGGAESPITELGIAGFNACKALST
KFAEDPSIASRPYDVDRDGFVMGEGAGILVLEELEHAKKRGAKIYCEVLGYGLTGDAYHI
TAPPPDGDGGKRSMSAALKSSQSNISDIDYINAHGTSTMADTIELGAVEALAMDYANKIS
MSSTKSSIGHLLGAAGSVEAIFSILSIRDQIVPPTINLEKQLSILKSI

KEGG   T30740 (Metagenome): 1105120007955Help
Entry
1105120007955     CDS       T30740                                 

Gene name
JCVI_PEP_1105120007955
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
cthi:THC_0263 (best score: 313.153)
Taxonomy
Thermodesulfobacteria [GN:cthi]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105120007955
LinkDB All DBs
AA seq 319 aa AA seqDB search
LDRSGHLSIFAAEEAIQDAGFDLSKPLGEDFGIVFGTGIGGIGATEDAVRVYDERGSTRI
SPLAITQLMPNSSTGQVAIKYGIQGPSLTITTACAASANAIGEAKRMIEQNIVDKVLVGG
TESGTTSMTIGAFAQIKALSKQNDEPQKACKPFDKNRDGFVMAEGSTVLILESESSAKDR
DAKIYGYISGYGSSTDAYHITAPSEGGVGALRAMEQAISNADISKEKIDYINAHGTSTPA
NDLNETLAIKSLMNDYAYEVNISSTKSMTGHLLGGGGAFEAMASLLSMKNSLIPPTINLN
DSDEDCDLNYTANHSIEKI

KEGG   T30740 (Metagenome): 1105108864183Help
Entry
1105108864183     CDS       T30740                                 

Gene name
JCVI_PEP_1105108864183
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 381.719)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105108864183
LinkDB All DBs
AA seq 238 aa AA seqDB search
RLSFTWKADAMICGGAEASITPLGVAGFASAKALSFRNDSPQTASRPFDAERDGFVIGEG
SGILVLETLENAQKRNARIYGEIIGYGTTCDAHHITAPSPGGVGGAEAIKLAIKDACLSL
EKVDYINAHGTSTSANDKNETSAIKSIFRDRSYLIPVSSTKSMTGHLLGGSGGIEAVACI
LSLTHNFIPPTINYVNRDPECDLDYVPNHAREAQLGVALSNSFGFGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105093911005Help
Entry
1105093911005     CDS       T30740                                 

Gene name
JCVI_PEP_1105093911005
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
psom:113310767 (best score: 31.187)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105093911005
LinkDB All DBs
AA seq 101 aa AA seqDB search
ILPVDVFGSSQKSIFFGILNPARVSLQKSINSFSFVSLSATFSINAHGTSPHFSSGFATT
ATIETAGCLESVFSISIEEIFSPPEIIISFDLSLTLMYPSG

KEGG   T30740 (Metagenome): 1105149003457Help
Entry
1105149003457     CDS       T30740                                 

Gene name
JCVI_PEP_1105149003457
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
pma:Pro_1769 (best score: 187.193)
Taxonomy
Cyanobacteria [GN:pma]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105149003457
LinkDB All DBs
AA seq 113 aa AA seqDB search
INAHGTSTSANDKNETSAIKSIFKDRSYLIPVSSTKSMTGHLLGGSGGIEAVACILSLTH
NFIPPTINYVNPDPECDLDYVPNNAREAQVGVALSNSFGFGGHNVCLAFSKMN

KEGG   T30740 (Metagenome): 1105095899241Help
Entry
1105095899241     CDS       T30740                                 

Gene name
JCVI_PEP_1105095899241
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
dav:DESACE_05495 (best score: 258.84)
Taxonomy
Deltaproteobacteria [GN:dav]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105095899241
LinkDB All DBs
AA seq 202 aa AA seqDB search
NGCSLMCFKPFDKDRDGFILSEGAGMLMLEDYDEAKRRNANIIGEIFGYGITNDAFHITQ
PDNESTGASNAITMALNDAGINASEVGYINAHGTSTYFNDMLETQAIKKVFGKDAKNVSI
SSTKSMTGHLLGAAGAIEAITCINTLNNGIIPPTINYNNPDPECDLDYTPNEAFKKDINI
SMSNSFGFGGHNSVVIFKKFSS

KEGG   T30740 (Metagenome): 1105080433603Help
Entry
1105080433603     CDS       T30740                                 

Gene name
JCVI_PEP_1105080433603
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
xba:C7S18_05365 (best score: 110.923)
Taxonomy
Gammaproteobacteria - Others [GN:xba]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105080433603
LinkDB All DBs
AA seq 88 aa AA seqDB search
LPTTLRQSTKSMTGHLLGAAAAIEAVFCVKALHHSYIPPTININELDQECDFDVTPNEGR
SREIDVAMSNSFGFGGTNASVIFRKMHS

KEGG   T30740 (Metagenome): 1105104833899Help
Entry
1105104833899     CDS       T30740                                 

Gene name
JCVI_PEP_1105104833899
Definition

  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
mca:MCA1999 (best score: 159.073)
Taxonomy
Gammaproteobacteria - Others [GN:mca]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
CAMERA GOS: JCVI_PEP_1105104833899
LinkDB All DBs
AA seq 134 aa AA seq