KEGG   T30765 (Metagenome): 1105120217933
Entry
1105120217933     CDS       T30765                                 

Gene name
JCVI_PEP_1105120217933
Definition

  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Best hit
fba:FIC_02118 (best score: 28.8758)
Pathway
04110  Cell cycle
04111  Cell cycle - yeast
04115  p53 signaling pathway
04218  Cellular senescence
05166  Human T-cell leukemia virus 1 infection
Other DBs
CAMERA GOS: JCVI_PEP_1105120217933
LinkDB
AA seq 65 aa
IFSRYKYSSKHFKIFMLVSEKGNMNGVIVFLSVHFSLSSVILKFKIGFLLSFTAFKNHVS
LANSL

DBGET integrated database retrieval system