KEGG   T30765 (Metagenome): 1105120218143
Entry
1105120218143     CDS       T30765                                 

Gene name
JCVI_PEP_1105120218143
Definition

  KO
K02407  flagellar hook-associated protein 2
Best hit
apb:SAR116_0839 (best score: 125.176)
Taxonomy
Alphaproteobacteria [GN:apb]
Pathway
02040  Flagellar assembly
Other DBs
CAMERA GOS: JCVI_PEP_1105120218143
LinkDB
AA seq 360 aa
TISSAFIKEIDVYTFQDADVANSDILNFTDQSVSEVAALLNDIDGISATTVDTTGEGTNY
SIIVTSDETGADNGFRITGDNSRFVTPSLPDASATTNKFSQLSSDAIFTLDGVQVTRESN
SITDLIDGATIEIKSDFETSASIGVSRSETNVLSTVNSVIDSLNEFKAEIDRLTFIDLEG
DENGPLALDPAVNAIKTSFKKLAIEPLNGYGDKSIYFSQLGIKTDSNGEYFLDEFIFDKT
FSENPEYFQVLKDENLAASTSSATVTKSPFTQLAVGSYTVSKDGDQWKFGDTNLTRFDHN
GGSMFTSTTYPGLVIKTAATEPASFTIYYGESFSTRVADLMEEIVEVGSPLKIRRNIQSR

DBGET integrated database retrieval system