KEGG   T30765 (Metagenome): 1105120218185
Entry
1105120218185     CDS       T30765                                 

Gene name
JCVI_PEP_1105120218185
Definition

  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Best hit
salp:111963329 (best score: 31.5722)
Pathway
04010  MAPK signaling pathway
04014  Ras signaling pathway
04151  PI3K-Akt signaling pathway
04722  Neurotrophin signaling pathway
05034  Alcoholism
Other DBs
CAMERA GOS: JCVI_PEP_1105120218185
LinkDB
AA seq 106 aa
ILASSPRFDTKSPFSIIGILDCLILVDVVRTATAPSLCASIMCESRDERSIDEAINKSPG
MTFLESPTSRNTLTGGKPGSRSSSLSSIKKPLKSYLFLSTSNTQDL

DBGET integrated database retrieval system