KEGG   T30765 (Metagenome): 1105120218499
Entry
1105120218499     CDS       T30765                                 

Gene name
JCVI_PEP_1105120218499
Definition

  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Best hit
dre:100002318 (best score: 31.187)
Pathway
01522  Endocrine resistance
04010  MAPK signaling pathway
04011  MAPK signaling pathway - yeast
04013  MAPK signaling pathway - fly
04015  Rap1 signaling pathway
04068  FoxO signaling pathway
04071  Sphingolipid signaling pathway
04114  Oocyte meiosis
04139  Mitophagy - yeast
04212  Longevity regulating pathway - worm
04218  Cellular senescence
04261  Adrenergic signaling in cardiomyocytes
04361  Axon regeneration
04370  VEGF signaling pathway
04380  Osteoclast differentiation
04550  Signaling pathways regulating pluripotency of stem cells
04611  Platelet activation
04620  Toll-like receptor signaling pathway
04621  NOD-like receptor signaling pathway
04622  RIG-I-like receptor signaling pathway
04624  Toll and Imd signaling pathway
04625  C-type lectin receptor signaling pathway
04657  IL-17 signaling pathway
04658  Th1 and Th2 cell differentiation
04659  Th17 cell differentiation
04660  T cell receptor signaling pathway
04664  Fc epsilon RI signaling pathway
04668  TNF signaling pathway
04670  Leukocyte transendothelial migration
04714  Thermogenesis
04722  Neurotrophin signaling pathway
04723  Retrograde endocannabinoid signaling
04728  Dopaminergic synapse
04750  Inflammatory mediator regulation of TRP channels
04912  GnRH signaling pathway
04914  Progesterone-mediated oocyte maturation
04917  Prolactin signaling pathway
04926  Relaxin signaling pathway
04933  AGE-RAGE signaling pathway in diabetic complications
04935  Growth hormone synthesis, secretion and action
05014  Amyotrophic lateral sclerosis
05120  Epithelial cell signaling in Helicobacter pylori infection
05130  Pathogenic Escherichia coli infection
05131  Shigellosis
05132  Salmonella infection
05133  Pertussis
05135  Yersinia infection
05140  Leishmaniasis
05142  Chagas disease
05145  Toxoplasmosis
05152  Tuberculosis
05161  Hepatitis B
05163  Human cytomegalovirus infection
05167  Kaposi sarcoma-associated herpesvirus infection
05169  Epstein-Barr virus infection
05170  Human immunodeficiency virus 1 infection
05205  Proteoglycans in cancer
05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
05418  Fluid shear stress and atherosclerosis
Other DBs
CAMERA GOS: JCVI_PEP_1105120218499
LinkDB
AA seq 108 aa
LLSSNYLKHMKHRKVLGVYQVFVKYHTKFLKFELVLCFQLYFFPTYKHAQCTNIKALLSQ
VHLKIVLKYLFQFQALQLYLLFVRWLKLLVTLLQEVQYLQNLQVTVHK

DBGET integrated database retrieval system