KEGG   T30765 (Metagenome): 1105120222447
Entry
1105120222447     CDS       T30765                                 

Gene name
JCVI_PEP_1105120222447
Definition

  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Best hit
thaa:CFI11_22865 (best score: 285.419)
Taxonomy
Alphaproteobacteria [GN:thaa]
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
02020  Two-component system
04260  Cardiac muscle contraction
04714  Thermogenesis
04932  Non-alcoholic fatty liver disease
05010  Alzheimer disease
05012  Parkinson disease
05014  Amyotrophic lateral sclerosis
05016  Huntington disease
Other DBs
CAMERA GOS: JCVI_PEP_1105120222447
LinkDB
AA seq 190 aa
LWSSIVAQNDENGTRRDFLFYATGGTAAVGTGAAVWPLINQMNPSADVKALASIRVDISE
IEPGTQLTVKWLGKPVFIRRRTETEIEEAKNVNLDELLDNAARNDNIAEASADDQNRSLD
ENGEWLVMMGVCTHLGCVPLGDGAGEYNGWFCPCHGSHYDTAGRIRKGPAPENLAVPKAV
FVDDSTIKLG

KEGG   T30765 (Metagenome): 1105120222249
Entry
1105120222249     CDS       T30765                                 

Gene name
JCVI_PEP_1105120222249
Definition

  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Best hit
suam:BOO69_00585 (best score: 652.514)
Taxonomy
Alphaproteobacteria [GN:suam]
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
02020  Two-component system
04260  Cardiac muscle contraction
04714  Thermogenesis
04932  Non-alcoholic fatty liver disease
05010  Alzheimer disease
05012  Parkinson disease
05014  Amyotrophic lateral sclerosis
05016  Huntington disease
Other DBs
CAMERA GOS: JCVI_PEP_1105120222249
LinkDB
AA seq 345 aa
VVHSRLPIVGLLYDTLMIPTPKNLNWMWIWGIVLTFCLALQIITGIVLAMHYTPHVDEAF
ASVEHIMRNVNGGHMLRYLHANGASLFFIAVYCHIFRGLYYGSYKAPREVTWIIGMLIYL
LMMGTAFMGYVLPWGQMSFWGATVITGLFGAIPFIGDALQTLLLGGPAVDNATLNRFFSL
HYLFPFLIAGLVIVHIWAFHTTGNNNPTGVEVRRTSKEEAEKDTVPFWPYFVIKDLFALA
VILVVFFAVVGFMPNYLGHPDNYIEANPLATPAHIVPEWYFLPFYAILRAFTADVWVVMI
VSFFTGGIIDAKFFGVLAMFGAILVMALAPWLDTSSVRSARYRPM

KEGG   T30765 (Metagenome): 1105120222449
Entry
1105120222449     CDS       T30765                                 

Gene name
JCVI_PEP_1105120222449
Definition

  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Best hit
thaa:CFI11_22860 (best score: 250.366)
Taxonomy
Alphaproteobacteria [GN:thaa]
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
02020  Two-component system
04260  Cardiac muscle contraction
04714  Thermogenesis
04932  Non-alcoholic fatty liver disease
05010  Alzheimer disease
05012  Parkinson disease
05014  Amyotrophic lateral sclerosis
05016  Huntington disease
Other DBs
CAMERA GOS: JCVI_PEP_1105120222449
LinkDB
AA seq 131 aa
ISMAGIPHDHYKPGSKGEKWLHSRLPIVGLLYDTLMIPTPKNLNWMWIWGIVLTFCLALQ
IITGIVLAMHYTPHVDEAFASVEHIMRNVNGGHMLRYLHANGASLFFIAVYCHIFRGLYY
GSYKAPRELHG

DBGET integrated database retrieval system