KEGG   T30765 (Metagenome): 1105120222467
Entry
1105120222467     CDS       T30765                                 

Gene name
JCVI_PEP_1105120222467
Definition

  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Best hit
rcu:8271162 (best score: 29.6462)
Pathway
04068  FoxO signaling pathway
04152  AMPK signaling pathway
04211  Longevity regulating pathway
04213  Longevity regulating pathway - multiple species
04371  Apelin signaling pathway
04530  Tight junction
04710  Circadian rhythm
04714  Thermogenesis
04910  Insulin signaling pathway
04920  Adipocytokine signaling pathway
04921  Oxytocin signaling pathway
04922  Glucagon signaling pathway
04931  Insulin resistance
04932  Non-alcoholic fatty liver disease
05410  Hypertrophic cardiomyopathy
Other DBs
CAMERA GOS: JCVI_PEP_1105120222467
LinkDB
AA seq 73 aa
IQRRYGLRVGSWDNTEKTRPCVRIGKENKVKVMLLLNIAKYASERDFHNQLLQTKGQDIE
SFTQHFKWDILEF

DBGET integrated database retrieval system