KEGG   T30856 (Metagenome): 149842Help
Entry
149842            CDS       T30856                                 

Gene name
42_DCM_0-0d2_C6724357_1_gene149842
Definition
strand:+ start:139 stop:924 length:786 start_codon:yes
stop_codon:yes gene_type:complete
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Best hit
maq:Maqu_1542 (best score: 468.774)
Taxonomy
Gammaproteobacteria - Others [GN:maq]Taxonomy
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01130  Biosynthesis of antibiotics
01212  Fatty acid metabolism
LinkDB All DBs
AA seq 261 aa AA seqDB search
MGILSGKKALIVGVASKLSIAYGIAEAFAREGAELAFTYQNEKLQPRVEKFAEQWGSKLT
FPCDVASDEEIENVFKELGKHWDNIDIIVHAVGYAPGHELDGNYVDVTTRDGFRIAHDIS
SYSFVALAKGARGMMHEGSSLITLSYLGAEKVLQNYNVMGLAKASLEANVRYMAASLGRD
GIRVNGISAGPIKTLAASGIKSFRKMLAENARRAPLRRNVTIDEVGNAAAFLGSDMSSGI
TGEIMYVDGGFNITGMGELEE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctcagtggcaagaaagcactgatcgttggcgtagccagcaaactgtccatt
gcttacggtatcgccgaggccttcgcccgcgagggtgccgaactggcgtttacctaccag
aatgaaaaacttcagccacgggttgagaagttcgccgaacagtggggaagcaagctgact
ttcccctgcgatgtcgcaagcgacgaagaaattgaaaacgtcttcaaagagctgggcaag
cactgggacaacatcgacatcattgtgcatgctgtcggctatgcgcctggacacgagctg
gacggcaactacgtcgacgtgaccacccgtgatggcttccgcattgcccacgatatcagc
tcctacagctttgtcgcgctggccaagggtgcccgcggcatgatgcatgaaggcagctcg
ctgattaccctgagctacctgggcgctgagaaggttctgcagaactacaatgtgatgggc
ttggccaaggcttccctggaagccaatgttcgctacatggccgccagcctgggccgggac
ggcattcgtgtgaatggcatttccgcgggtccgatcaagaccctggccgcctctggcatc
aagagcttccgtaagatgctggccgaaaatgccaggcgtgcgccgctgcggcgaaacgtc
accatcgacgaagtgggtaatgctgctgcattcctcggctctgatatgtcctccggtatt
accggcgagatcatgtacgtggacggcggcttcaacattaccggaatgggtgaacttgaa
gagtaa

KEGG   T30856 (Metagenome): 167562Help
Entry
167562            CDS       T30856                                 

Gene name
42_DCM_0-0d2_C6743841_1_gene167562
Definition
strand:- start:2 stop:130 length:129 start_codon:yes stop_codon:no
gene_type:incomplete
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Best hit
mej:Q7A_2205 (best score: 85.1149)
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01130  Biosynthesis of antibiotics
01212  Fatty acid metabolism
LinkDB All DBs
AA seq 43 aa AA seqDB search
MGFLQGKRVLIVGVASSRSIAAGIAHAMAREGAELAFTYQNDK
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctacaaggtaaacgggtattgattgttggcgtggccagctcgcgttctatc
gctgccggtattgcgcatgcgatggctcgtgaaggcgcagaactggcttttacctaccaa
aatgacaaa

KEGG   T30856 (Metagenome): 141773Help
Entry
141773            CDS       T30856                                 

Gene name
42_DCM_0-0d2_C6714813_1_gene141773
Definition
strand:+ start:1 stop:141 length:141 start_codon:no stop_codon:yes
gene_type:incomplete
  KO
K02371  enoyl-[acyl-carrier protein] reductase II [EC:1.3.1.9]
Best hit
taj:C1A40_17475 asl:Aeqsu_0051 (best score: 58.151)
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
LinkDB All DBs
AA seq 46 aa AA seqDB search
EGDLEEGELEIGQIAGLIHDIKPAATILHDMLKEYELAKKEVSNLF
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
gaaggggatttagaagaaggagaattggaaattgggcaaattgccggactcattcatgat
ataaaaccagctgctactattttacatgatatgctaaaagaatatgagttagccaaaaaa
gaagtttctaatcttttctaa

DBGET integrated database retrieval system