KEGG   T30911 (Metagenome): 102369Help
Entry
102369            CDS       T30911                                 

Gene name
72_DCM_0-0d2_C4228930_1_gene102369
Definition
strand:+ start:14 stop:208 length:195 start_codon:yes stop_codon:yes
gene_type:complete
  KO
K03099  son of sevenless
Best hit
clv:102089495 apla:101804628 fpg:101913074 aam:106495130 gga:423572
nni:104019491 egz:104135007 acun:113480382 (best score: 30.8018)
Pathway
01521  EGFR tyrosine kinase inhibitor resistance
01522  Endocrine resistance
04010  MAPK signaling pathway
04012  ErbB signaling pathway
04013  MAPK signaling pathway - fly
04014  Ras signaling pathway
04062  Chemokine signaling pathway
04068  FoxO signaling pathway
04072  Phospholipase D signaling pathway
04150  mTOR signaling pathway
04151  PI3K-Akt signaling pathway
04320  Dorso-ventral axis formation
04510  Focal adhesion
04540  Gap junction
04630  JAK-STAT signaling pathway
04650  Natural killer cell mediated cytotoxicity
04660  T cell receptor signaling pathway
04662  B cell receptor signaling pathway
04664  Fc epsilon RI signaling pathway
04714  Thermogenesis
04722  Neurotrophin signaling pathway
04810  Regulation of actin cytoskeleton
04910  Insulin signaling pathway
04912  GnRH signaling pathway
04915  Estrogen signaling pathway
04917  Prolactin signaling pathway
04926  Relaxin signaling pathway
05034  Alcoholism
05160  Hepatitis C
05161  Hepatitis B
05163  Human cytomegalovirus infection
05165  Human papillomavirus infection
05200  Pathways in cancer
05205  Proteoglycans in cancer
05206  MicroRNAs in cancer
05210  Colorectal cancer
05211  Renal cell carcinoma
05213  Endometrial cancer
05214  Glioma
05215  Prostate cancer
05220  Chronic myeloid leukemia
05221  Acute myeloid leukemia
05223  Non-small cell lung cancer
05224  Breast cancer
05225  Hepatocellular carcinoma
05226  Gastric cancer
05231  Choline metabolism in cancer
LinkDB All DBs
AA seq 64 aa AA seqDB search
MIKIEKIEGPLDWYKATVKTLKETVEFEGPPKTIEWHVNDYLFRNGHQIEDVKKIIQEYH
KNSS
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatagaaaaaatagaaggtccacttgattggtacaaggctacagttaaaaca
ctaaaagaaactgtagaatttgaaggacccccaaaaacaattgaatggcatgtaaatgat
tacttatttagaaatggtcatcaaattgaagatgttaaaaaaataatacaagagtatcat
aaaaatagttcttga

DBGET integrated database retrieval system