KEGG   T30911 (Metagenome): 27498Help
Entry
27498             CDS       T30911                                 

Gene name
72_DCM_0-0d2_scaffold50673_1_gene27498
Definition
strand:- start:3 stop:68 length:66 start_codon:yes stop_codon:no
gene_type:incomplete
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Best hit
csat:104773120 (best score: 24.2534)
Pathway
00562  Inositol phosphate metabolism
01100  Metabolic pathways
04015  Rap1 signaling pathway
04020  Calcium signaling pathway
04022  cGMP-PKG signaling pathway
04062  Chemokine signaling pathway
04070  Phosphatidylinositol signaling system
04071  Sphingolipid signaling pathway
04072  Phospholipase D signaling pathway
04261  Adrenergic signaling in cardiomyocytes
04270  Vascular smooth muscle contraction
04310  Wnt signaling pathway
04371  Apelin signaling pathway
04540  Gap junction
04611  Platelet activation
04621  NOD-like receptor signaling pathway
04713  Circadian entrainment
04720  Long-term potentiation
04723  Retrograde endocannabinoid signaling
04724  Glutamatergic synapse
04725  Cholinergic synapse
04726  Serotonergic synapse
04728  Dopaminergic synapse
04730  Long-term depression
04745  Phototransduction - fly
04750  Inflammatory mediator regulation of TRP channels
04911  Insulin secretion
04912  GnRH signaling pathway
04915  Estrogen signaling pathway
04916  Melanogenesis
04918  Thyroid hormone synthesis
04919  Thyroid hormone signaling pathway
04921  Oxytocin signaling pathway
04922  Glucagon signaling pathway
04924  Renin secretion
04925  Aldosterone synthesis and secretion
04926  Relaxin signaling pathway
04927  Cortisol synthesis and secretion
04928  Parathyroid hormone synthesis, secretion and action
04933  AGE-RAGE signaling pathway in diabetic complications
04934  Cushing syndrome
04961  Endocrine and other factor-regulated calcium reabsorption
04970  Salivary secretion
04971  Gastric acid secretion
04972  Pancreatic secretion
05010  Alzheimer disease
05016  Huntington disease
05142  Chagas disease (American trypanosomiasis)
05143  African trypanosomiasis
05146  Amoebiasis
05163  Human cytomegalovirus infection
05200  Pathways in cancer
LinkDB All DBs
AA seq 22 aa AA seqDB search
MLRKVKLYGKLAKFVGHRVLEA
NT seq 66 nt NT seq  +upstreamnt  +downstreamnt
atgcttagaaaggtcaaattatatggaaaacttgcaaagtttgtcggtcatagagtttta
gaagca

KEGG   T30911 (Metagenome): 34417Help
Entry
34417             CDS       T30911                                 

Gene name
72_DCM_0-0d2_scaffold61632_1_gene34417
Definition
strand:- start:181 stop:750 length:570 start_codon:no stop_codon:yes
gene_type:incomplete
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Best hit
csh:Closa_1464 spar:SPRG_13735 (best score: 32.7278)
Pathway
00562  Inositol phosphate metabolism
01100  Metabolic pathways
04015  Rap1 signaling pathway
04020  Calcium signaling pathway
04022  cGMP-PKG signaling pathway
04062  Chemokine signaling pathway
04070  Phosphatidylinositol signaling system
04071  Sphingolipid signaling pathway
04072  Phospholipase D signaling pathway
04261  Adrenergic signaling in cardiomyocytes
04270  Vascular smooth muscle contraction
04310  Wnt signaling pathway
04371  Apelin signaling pathway
04540  Gap junction
04611  Platelet activation
04621  NOD-like receptor signaling pathway
04713  Circadian entrainment
04720  Long-term potentiation
04723  Retrograde endocannabinoid signaling
04724  Glutamatergic synapse
04725  Cholinergic synapse
04726  Serotonergic synapse
04728  Dopaminergic synapse
04730  Long-term depression
04745  Phototransduction - fly
04750  Inflammatory mediator regulation of TRP channels
04911  Insulin secretion
04912  GnRH signaling pathway
04915  Estrogen signaling pathway
04916  Melanogenesis
04918  Thyroid hormone synthesis
04919  Thyroid hormone signaling pathway
04921  Oxytocin signaling pathway
04922  Glucagon signaling pathway
04924  Renin secretion
04925  Aldosterone synthesis and secretion
04926  Relaxin signaling pathway
04927  Cortisol synthesis and secretion
04928  Parathyroid hormone synthesis, secretion and action
04933  AGE-RAGE signaling pathway in diabetic complications
04934  Cushing syndrome
04961  Endocrine and other factor-regulated calcium reabsorption
04970  Salivary secretion
04971  Gastric acid secretion
04972  Pancreatic secretion
05010  Alzheimer disease
05016  Huntington disease
05142  Chagas disease (American trypanosomiasis)
05143  African trypanosomiasis
05146  Amoebiasis
05163  Human cytomegalovirus infection
05200  Pathways in cancer
LinkDB All DBs
AA seq 189 aa AA seqDB search
VGRLTTYIVFNKMENVMNNLKKFVNYAQPVVKAVKENHNEFHRLEYFSVNAEDLFAEEGL
IEFMTENKYDPKHFNGVIPLVYAQWGEETGASIVLELSAEQRQLLSPEVATTLLGEDYKL
WENGVVYLLMDHEYYQTCAGFTVTEQIDPTNGGVSNAIDFLCRNLGLNYLTIDFPYSRTE
SMLYWSEDE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtaggtagattaactacttacattgtgtttaacaaaatggagaatgtaatgaacaatctt
aaaaagtttgtgaattatgctcaaccagtagtcaaagctgtaaaggaaaatcataacgaa
tttcatcgtcttgaatatttcagtgtcaacgctgaagatctatttgccgaagagggttta
atagaattcatgacagaaaataagtatgatcccaaacactttaatggtgttataccttta
gtttatgctcaatggggggaagaaactggggctagtatagtcctagaattatccgctgaa
cagcgtcaactattaagtcccgaagtggctactactctactgggtgaagactataaacta
tgggaaaatggcgtagtttatttacttatggatcatgagtattatcagacatgtgctggt
tttacggtcactgaacagattgatccaactaatggtggggtgtctaatgctatagacttc
ctgtgtcgtaatttaggtcttaactaccttactatagattttccgtatagtcgtacagag
tctatgttatattggagtgaagatgaatag

KEGG   T30911 (Metagenome): 99545Help
Entry
99545             CDS       T30911                                 

Gene name
72_DCM_0-0d2_C4221816_1_gene99545
Definition
strand:- start:2 stop:154 length:153 start_codon:yes stop_codon:no
gene_type:incomplete
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Best hit
xla:445848 (best score: 29.261)
Pathway
00562  Inositol phosphate metabolism
01100  Metabolic pathways
04015  Rap1 signaling pathway
04020  Calcium signaling pathway
04022  cGMP-PKG signaling pathway
04062  Chemokine signaling pathway
04070  Phosphatidylinositol signaling system
04071  Sphingolipid signaling pathway
04072  Phospholipase D signaling pathway
04261  Adrenergic signaling in cardiomyocytes
04270  Vascular smooth muscle contraction
04310  Wnt signaling pathway
04371  Apelin signaling pathway
04540  Gap junction
04611  Platelet activation
04621  NOD-like receptor signaling pathway
04713  Circadian entrainment
04720  Long-term potentiation
04723  Retrograde endocannabinoid signaling
04724  Glutamatergic synapse
04725  Cholinergic synapse
04726  Serotonergic synapse
04728  Dopaminergic synapse
04730  Long-term depression
04745  Phototransduction - fly
04750  Inflammatory mediator regulation of TRP channels
04911  Insulin secretion
04912  GnRH signaling pathway
04915  Estrogen signaling pathway
04916  Melanogenesis
04918  Thyroid hormone synthesis
04919  Thyroid hormone signaling pathway
04921  Oxytocin signaling pathway
04922  Glucagon signaling pathway
04924  Renin secretion
04925  Aldosterone synthesis and secretion
04926  Relaxin signaling pathway
04927  Cortisol synthesis and secretion
04928  Parathyroid hormone synthesis, secretion and action
04933  AGE-RAGE signaling pathway in diabetic complications
04934  Cushing syndrome
04961  Endocrine and other factor-regulated calcium reabsorption
04970  Salivary secretion
04971  Gastric acid secretion
04972  Pancreatic secretion
05010  Alzheimer disease
05016  Huntington disease
05142  Chagas disease (American trypanosomiasis)
05143  African trypanosomiasis
05146  Amoebiasis
05163  Human cytomegalovirus infection
05200  Pathways in cancer
LinkDB All DBs
AA seq 51 aa AA seqDB search
MAAIFDKINKTPKDPRIEAVLESVSKTLANTRSQAFEHKTCVTCGKDVGTF
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaatttttgacaaaataaacaaaacacctaaagatcctagaatcgaagcagtt
cttgaatctgtaagcaaaacccttgctaacacaagaagccaagcttttgaacacaaaact
tgtgttacttgtggaaaggatgttggtactttt

KEGG   T30911 (Metagenome): 111738Help
Entry
111738            CDS       T30911                                 

Gene name
72_DCM_0-0d2_C4251728_1_gene111738
Definition
strand:+ start:313 stop:582 length:270 start_codon:yes stop_codon:no
gene_type:incomplete
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Best hit
ddi:DDB_G0270444 eao:BD94_0201 (best score: 31.5722)
Pathway
00562  Inositol phosphate metabolism
01100  Metabolic pathways
04015  Rap1 signaling pathway
04020  Calcium signaling pathway
04022  cGMP-PKG signaling pathway
04062  Chemokine signaling pathway
04070  Phosphatidylinositol signaling system
04071  Sphingolipid signaling pathway
04072  Phospholipase D signaling pathway
04261  Adrenergic signaling in cardiomyocytes
04270  Vascular smooth muscle contraction
04310  Wnt signaling pathway
04371  Apelin signaling pathway
04540  Gap junction
04611  Platelet activation
04621  NOD-like receptor signaling pathway
04713  Circadian entrainment
04720  Long-term potentiation
04723  Retrograde endocannabinoid signaling
04724  Glutamatergic synapse
04725  Cholinergic synapse
04726  Serotonergic synapse
04728  Dopaminergic synapse
04730  Long-term depression
04745  Phototransduction - fly
04750  Inflammatory mediator regulation of TRP channels
04911  Insulin secretion
04912  GnRH signaling pathway
04915  Estrogen signaling pathway
04916  Melanogenesis
04918  Thyroid hormone synthesis
04919  Thyroid hormone signaling pathway
04921  Oxytocin signaling pathway
04922  Glucagon signaling pathway
04924  Renin secretion
04925  Aldosterone synthesis and secretion
04926  Relaxin signaling pathway
04927  Cortisol synthesis and secretion
04928  Parathyroid hormone synthesis, secretion and action
04933  AGE-RAGE signaling pathway in diabetic complications
04934  Cushing syndrome
04961  Endocrine and other factor-regulated calcium reabsorption
04970  Salivary secretion
04971  Gastric acid secretion
04972  Pancreatic secretion
05010  Alzheimer disease
05016  Huntington disease
05142  Chagas disease (American trypanosomiasis)
05143  African trypanosomiasis
05146  Amoebiasis
05163  Human cytomegalovirus infection
05200  Pathways in cancer
LinkDB All DBs
AA seq 90 aa AA seqDB search
MKKSELRQIVREELQNVLSEVYQDKFRISGRLVTNIKERSQTEILSDIRAIAGVTIVSTD
EIQDYSEQRRGRFISVLNLKVDGFPYMKSG
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcagaactaagacaaattgttagagaagaattacaaaatgttctttctgaa
gtatatcaagataaatttagaattagtggacgtctagttacaaacattaaagaaagatcc
caaacagaaatattatctgatattagagcaattgctggtgtaactatagtttcaacagat
gaaatacaagattatagtgagcaacgtcgtggtagatttatatctgtcctgaatttaaaa
gtagatggatttccatatatgaaatcagga

KEGG   T30911 (Metagenome): 115181Help
Entry
115181            CDS       T30911                                 

Gene name
72_DCM_0-0d2_C4260094_1_gene115181
Definition
strand:- start:3 stop:605 length:603 start_codon:no stop_codon:no
gene_type:incomplete
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Best hit
aqu:105313260 (best score: 39.6614)
Pathway
00562  Inositol phosphate metabolism
01100  Metabolic pathways
04015  Rap1 signaling pathway
04020  Calcium signaling pathway
04022  cGMP-PKG signaling pathway
04062  Chemokine signaling pathway
04070  Phosphatidylinositol signaling system
04071  Sphingolipid signaling pathway
04072  Phospholipase D signaling pathway
04261  Adrenergic signaling in cardiomyocytes
04270  Vascular smooth muscle contraction
04310  Wnt signaling pathway
04371  Apelin signaling pathway
04540  Gap junction
04611  Platelet activation
04621  NOD-like receptor signaling pathway
04713  Circadian entrainment
04720  Long-term potentiation
04723  Retrograde endocannabinoid signaling
04724  Glutamatergic synapse
04725  Cholinergic synapse
04726  Serotonergic synapse
04728  Dopaminergic synapse
04730  Long-term depression
04745  Phototransduction - fly
04750  Inflammatory mediator regulation of TRP channels
04911  Insulin secretion
04912  GnRH signaling pathway
04915  Estrogen signaling pathway
04916  Melanogenesis
04918  Thyroid hormone synthesis
04919  Thyroid hormone signaling pathway
04921  Oxytocin signaling pathway
04922  Glucagon signaling pathway
04924  Renin secretion
04925  Aldosterone synthesis and secretion
04926  Relaxin signaling pathway
04927  Cortisol synthesis and secretion
04928  Parathyroid hormone synthesis, secretion and action
04933  AGE-RAGE signaling pathway in diabetic complications
04934  Cushing syndrome
04961  Endocrine and other factor-regulated calcium reabsorption
04970  Salivary secretion
04971  Gastric acid secretion
04972  Pancreatic secretion
05010  Alzheimer disease
05016  Huntington disease
05142  Chagas disease (American trypanosomiasis)
05143  African trypanosomiasis
05146  Amoebiasis
05163  Human cytomegalovirus infection
05200  Pathways in cancer
LinkDB All DBs
AA seq 201 aa AA seqDB search
QQMLSMGYSQEDAEKVSEEEIPIVEFKQITYEDLINMKNIDIVKISTKKVKQCVIVGDKH
LYSRILPLDKYPLIPIMNVHTRTPYPVSDVRMIKGLQEYINKTRSLIIAHATTSTNTKIL
VPEGSVDMKEFEEKWAQPGVAIPYDPTDGAPMPVQPVPLPNELYQNELTAKNDIDHALGL
YEMMMGNSQAAPQTYKATISI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
caacaaatgcttagtatgggttattcacaagaagatgctgagaaagtatctgaagaagag
attcctattgtagaatttaaacaaattacttatgaagatttaattaatatgaaaaatata
gatattgttaaaatatctactaaaaaagttaaacaatgtgttattgtaggagataaacat
ctttattctaggattcttccattagacaagtatcctttaattcctataatgaatgtacat
acaagaactccttatccagtatctgatgttagaatgataaagggattacaggaatatata
aataaaacacgctctttgataattgcacatgccactacaagtactaataccaagatactt
gtaccagaaggtagtgttgatatgaaagaatttgaagaaaagtgggctcaacctggagta
gctattccatatgaccctactgacggagctcctatgccggttcaaccagttcctcttcca
aatgaattatatcaaaatgaattaactgccaagaatgatatagaccatgctttaggatta
tatgaaatgatgatgggtaactctcaagctgctcctcaaacatataaagctactatatct
ata

DBGET integrated database retrieval system