KEGG   T30911 (Metagenome): 46517Help
Entry
46517             CDS       T30911                                 

Gene name
72_DCM_0-0d2_scaffold79095_1_gene46517
Definition
strand:+ start:2 stop:394 length:393 start_codon:no stop_codon:yes
gene_type:incomplete
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Best hit
bju:BJ6T_01790 (best score: 30.8018)
Pathway
01521  EGFR tyrosine kinase inhibitor resistance
04010  MAPK signaling pathway
04012  ErbB signaling pathway
04014  Ras signaling pathway
04015  Rap1 signaling pathway
04020  Calcium signaling pathway
04062  Chemokine signaling pathway
04064  NF-kappa B signaling pathway
04066  HIF-1 signaling pathway
04070  Phosphatidylinositol signaling system
04071  Sphingolipid signaling pathway
04150  mTOR signaling pathway
04270  Vascular smooth muscle contraction
04310  Wnt signaling pathway
04370  VEGF signaling pathway
04510  Focal adhesion
04540  Gap junction
04650  Natural killer cell mediated cytotoxicity
04662  B cell receptor signaling pathway
04666  Fc gamma R-mediated phagocytosis
04670  Leukocyte transendothelial migration
04713  Circadian entrainment
04720  Long-term potentiation
04723  Retrograde endocannabinoid signaling
04724  Glutamatergic synapse
04725  Cholinergic synapse
04726  Serotonergic synapse
04727  GABAergic synapse
04728  Dopaminergic synapse
04730  Long-term depression
04750  Inflammatory mediator regulation of TRP channels
04911  Insulin secretion
04912  GnRH signaling pathway
04916  Melanogenesis
04918  Thyroid hormone synthesis
04919  Thyroid hormone signaling pathway
04921  Oxytocin signaling pathway
04925  Aldosterone synthesis and secretion
04928  Parathyroid hormone synthesis, secretion and action
04931  Insulin resistance
04933  AGE-RAGE signaling pathway in diabetic complications
04960  Aldosterone-regulated sodium reabsorption
04961  Endocrine and other factor-regulated calcium reabsorption
04970  Salivary secretion
04971  Gastric acid secretion
04972  Pancreatic secretion
04973  Carbohydrate digestion and absorption
05031  Amphetamine addiction
05032  Morphine addiction
05140  Leishmaniasis
05143  African trypanosomiasis
05146  Amoebiasis
05161  Hepatitis B
05163  Human cytomegalovirus infection
05164  Influenza A
05170  Human immunodeficiency virus 1 infection
05200  Pathways in cancer
05205  Proteoglycans in cancer
05206  MicroRNAs in cancer
05214  Glioma
05223  Non-small cell lung cancer
05225  Hepatocellular carcinoma
05231  Choline metabolism in cancer
LinkDB All DBs
AA seq 130 aa AA seqDB search
PFPHQDILFLAQEVWDWQVLDEIGSTAFYVGQFQEGYDACMQLLKENKFPEDERQRIMGN
LEQYQIKMAELQAQNAEQEARVNEMNAEMEQKKQERLAKEALEKEEEKATRKAKTEARNK
KFKKRKKQKA
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
ccattcccacatcaagatattctgttcctagcacaagaagtttgggactggcaagttctt
gatgagattggttctactgcattctatgttggtcagttccaagagggatatgatgcttgt
atgcaattactcaaggaaaataaattcccagaggatgagcgacaaaggattatgggaaat
cttgaacagtatcaaataaagatggcagaacttcaggctcagaatgcagagcaagaggca
agagtaaatgaaatgaacgctgaaatggaacaaaagaaacaagaaagacttgccaaagaa
gcactagaaaaggaagaagaaaaggcgactcgtaaagcaaagacggaagcaagaaacaag
aaattcaagaaacgaaagaaacaaaaggcatag

DBGET integrated database retrieval system