KEGG   T31050 (Metagenome): 17741Help
Entry
17741             CDS       T31050                                 

Definition
OSD10_2014-06-21_1m_NPL022_spades_contig-22304_+_265_726_orf-2
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Best hit
paa:Paes_0006 (best score: 53.5286)
Pathway
03030  DNA replication
03410  Base excision repair
03420  Nucleotide excision repair
LinkDB All DBs
AA seq 154 aa AA seqDB search
MYRKLFEIIKELKPTIIGGYNSASFDFPFILKRAEILGVDIVECTSILTSDGIKQKEGVL
KLANEIEPYTQHIIWGHNIVDIAHAVRRAQAINSEIKSWGLKYITQYLEKEKPNRVYVDG
AFISKIYLENDSYYVNPKTGKYKKIGEPGTENLL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgaaaactttttgaaataataaaagaattaaaaccaacaattattggtgggtat
aattcagcgtcatttgactttccattcatattaaaaagagccgaaattttaggtgttgat
attgttgagtgtacatcaatactcacatcggatgggattaaacaaaaagaaggtgtatta
aagttagcaaatgaaattgaaccttacactcaacatatcatttggggtcataatattgtt
gatatcgctcacgcagtaagaagggcacaagcaattaattcggaaattaaatcttgggga
ttgaaatacattacccaatatttggaaaaagaaaaaccaaatcgggtatatgtcgatggt
gcttttatttcaaaaatatatttggaaaatgatagttattacgttaaccctaaaacaggt
aaatacaaaaagattggtgaacccggtactgaaaatttatta

KEGG   T31050 (Metagenome): 56352Help
Entry
56352             CDS       T31050                                 

Definition
OSD10_2014-06-21_1m_NPL022_spades_contig-70847_+_334_648_orf-2
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Best hit
vg:2943422 (best score: 43.1282)
Pathway
03030  DNA replication
03410  Base excision repair
03420  Nucleotide excision repair
LinkDB All DBs
AA seq 104 aa AA seqDB search
MIIEFFKTIDELKPSLIGGYNSAFFDFPFILKRAEILNLNIKKISKTLNPDYSLKQKDGI
LKLANEMEPYVQTQMWGYNIVDIAHAVRRAQAINSDIKTNTQIT
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgattattgagttttttaaaacaattgacgaattaaaaccttctcttattggtggttac
aattcagccttctttgacttcccgttcattttaaaacgagcggaaatattaaatttaaac
attaaaaaaatatccaaaactttaaatcccgattattcattaaaacaaaaggacggtatt
ttaaagttagcaaatgagatggaaccttatgttcaaactcaaatgtggggttataatatt
gtggacattgcacatgcggttcgtagagcacaagcaattaactcagacattaaaacaaat
acgcaaattacgtaa

DBGET integrated database retrieval system