KEGG   T31106 (Metagenome): 14882
Entry
14882             CDS       T31106                                 

Definition
OSD80_2014-06-21_0m_NPL022_spades_contig-23083_-_32_433_orf-1
  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Best hit
pmur:107300544 (best score: 75.8701)
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
02020  Two-component system
04260  Cardiac muscle contraction
04714  Thermogenesis
04932  Non-alcoholic fatty liver disease
05010  Alzheimer disease
05012  Parkinson disease
05014  Amyotrophic lateral sclerosis
05016  Huntington disease
LinkDB
AA seq 133 aa
MLCGLLTPLHIVPEWYFLCQYAMLKAVPNKNAGFIILLTSIFTFFFFGEIRNLTTFTRLM
DYNNGFSLSSFFLSLLIFLWIGAQFPQEKFLSYGRILTLHYYFLLMCILFSLYFSSAFQK
RFPKKLQERVCVH
NT seq 402 nt   +upstreamnt  +downstreamnt
gtgctttgtggattacttactcctttacatatagtacctgaatggtatttcctatgccaa
tatgctatgttaaaagctgtgcccaacaaaaatgcaggattcataatcttattaacttct
atcttcactttctttttctttggagaaattagaaatctaacaacttttacaagattaatg
gattataataatggtttttctctttcatctttctttctttctcttcttatatttctttgg
ataggtgctcaattccctcaagagaagtttctatcttatggtcgtatcttgacattacat
tattattttcttcttatgtgtatcttattttcattatatttttcttcagccttccagaaa
cgattcccaaagaaattgcaggagagagtttgtgtccactga

DBGET integrated database retrieval system