KEGG   T31106 (Metagenome): 17241
Entry
17241             CDS       T31106                                 

Definition
OSD80_2014-06-21_0m_NPL022_spades_contig-26686_+_192_923_orf-1
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Best hit
ptm:GSPATT00013163001 (best score: 275.789)
Taxonomy
Alveolates [GN:ptm]
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
02020  Two-component system
04260  Cardiac muscle contraction
04714  Thermogenesis
04932  Non-alcoholic fatty liver disease
05010  Alzheimer disease
05012  Parkinson disease
05014  Amyotrophic lateral sclerosis
05016  Huntington disease
LinkDB
AA seq 243 aa
MQEYNDRKNKKLINNLLCTERPTYWVTSSRPSNFGDPLDTKTKADNWFDENRVWNEENRD
YEIKRAQIYMLQGFVISSYVIGIKTIVSVIYNQMITRTRYIRDSYKELDIGELPPGEVLQ
TSWNGEIIFVRRLTMTEVKDTNALPLTTQLDKDSVTTLSNAGNSEILVCSAICTHLGCIP
VPYLGAYKGWVCLCHGSVYDKFGRVRQGPAQSNLPFINNSVFGAVVCIEEQQFPNEPSIF
LYV
NT seq 732 nt   +upstreamnt  +downstreamnt
atgcaagaatacaacgatagaaagaacaagaagcttattaacaaccttttgtgtaccgaa
agaccaacttactgggttacctcttcaagaccatccaacttcggagaccccctcgacacc
aagaccaaagctgataactggttcgatgagaacagagtctggaacgaggaaaacagagat
tatgagatcaagagagctcaaatctacatgctccaaggatttgtcatttcctcatacgtg
attggtatcaagaccatcgtctctgtcatctataaccagatgatcaccagaacaagatac
atcagagactcctacaaggagctcgatatcggagagcttcctccaggagaggttcttcag
acctcttggaacggtgagatcatcttcgttagaagacttaccatgactgaggttaaggac
accaatgctcttccactcaccacccaattggataaagattccgttaccaccctttccaac
gccggtaactccgagattttggtgtgctccgccatttgcacccatttgggttgcatccca
gttccatatcttggagcctacaagggatgggtttgcttgtgccatggatccgtctacgat
aagttcggaagagtcagacaaggaccagctcagtccaacttgccattcatcaataactcc
gtcttcggagcagttgtgtgcattgaggagcaacagttccccaatgagccatccatcttc
ctctatgtgtga

DBGET integrated database retrieval system