KEGG   Acidovorax avenae: Acav_0058Help
Entry
Acav_0058         CDS       T01445                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aaa  Acidovorax avenae
Pathway
aaa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Acav_0058
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aaa02000]
    Acav_0058
Enzymes [BR:aaa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Acav_0058
Transporters [BR:aaa02000]
 Other Transporters
  Pores ion channels [TC:1]
   Acav_0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_3 GST_N GST_C_2 GST_N_2 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: ADX43985
UniProt: F0Q0A2
LinkDB All DBs
Position
complement(72128..72772)
Genome map
AA seq 214 aa AA seqDB search
MAGLFHCLQNLTMKLYYSPGACSLSPHIALHEAGLAFTPVLASTKSHKLQDGTDFYTINP
LGYVPVLELDDGTRLREGPAIVQYIADQAPHKNLAPANGTLARYRLQEWLNFIGTELHKG
HSPLFQANTPDAYKPIVREKLLSRFQWLDEQLAGKEWLMGEHFSVADGYLFTVSGWGKHV
GVDHSGLPNLQAYLARVGARPAVQAALKAEGLQK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcttgttccactgccttcagaacctgaccatgaagctctactacagtcctggt
gcctgctcgctgtccccgcacatcgccctgcacgaggccggcctggccttcacccccgtg
ctcgcgagcacgaagagccacaagctccaggacgggaccgacttctacaccatcaacccc
ctcggctatgtgccggtactggagctcgacgatggcacccgcctgcgcgaaggccccgcc
atcgtgcaatacatcgcagaccaggcaccccacaagaacctggcgcccgccaacggcacg
ctggcgcgctaccgcctccaggagtggctgaacttcatcggcacggagttgcacaagggc
cacagcccgctgttccaggccaacacgcccgatgcgtacaagcccatcgtgcgcgagaag
ctgctgtcgcgcttccagtggctggacgaacagctcgccggcaaggaatggctgatgggc
gagcatttctccgtggcagatggctacctgttcaccgtgagcggctggggcaagcacgtg
ggcgtggaccattccggcctgccgaacctgcaggcctatctggcacgcgtgggcgcccgc
ccggccgtgcaggccgccctcaaggcagagggcctgcagaagtaa

DBGET integrated database retrieval system